Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACI2O8_RS16795 Genome accession   NZ_CP173415
Coordinates   3199534..3199674 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain FJYA24     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3194534..3204674
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACI2O8_RS16770 (ACI2O8_16770) yuxO 3194876..3195256 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  ACI2O8_RS16775 (ACI2O8_16775) comA 3195275..3195919 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ACI2O8_RS16780 (ACI2O8_16780) comP 3196000..3198300 (-) 2301 WP_088300729.1 histidine kinase Regulator
  ACI2O8_RS16785 (ACI2O8_16785) comX 3198312..3198476 (-) 165 WP_015384519.1 competence pheromone ComX -
  ACI2O8_RS16790 (ACI2O8_16790) - 3198489..3199349 (-) 861 WP_128422373.1 polyprenyl synthetase family protein -
  ACI2O8_RS16795 (ACI2O8_16795) degQ 3199534..3199674 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ACI2O8_RS16800 (ACI2O8_16800) - 3199896..3200021 (+) 126 WP_144500545.1 hypothetical protein -
  ACI2O8_RS16805 (ACI2O8_16805) - 3200135..3200503 (+) 369 WP_144500544.1 hypothetical protein -
  ACI2O8_RS16810 (ACI2O8_16810) pdeH 3200479..3201708 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  ACI2O8_RS16815 (ACI2O8_16815) pncB 3201845..3203317 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  ACI2O8_RS16820 (ACI2O8_16820) pncA 3203333..3203884 (-) 552 WP_015714627.1 cysteine hydrolase family protein -
  ACI2O8_RS16825 (ACI2O8_16825) yueI 3203981..3204379 (-) 399 WP_085185940.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=1072126 ACI2O8_RS16795 WP_003220708.1 3199534..3199674(-) (degQ) [Bacillus subtilis strain FJYA24]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1072126 ACI2O8_RS16795 WP_003220708.1 3199534..3199674(-) (degQ) [Bacillus subtilis strain FJYA24]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment