Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ACI2O8_RS12765 Genome accession   NZ_CP173415
Coordinates   2465671..2465844 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain FJYA24     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2460671..2470844
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACI2O8_RS12750 (ACI2O8_12750) gcvT 2461471..2462559 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  ACI2O8_RS12755 (ACI2O8_12755) hepAA 2463000..2464673 (+) 1674 WP_029726726.1 DEAD/DEAH box helicase -
  ACI2O8_RS12760 (ACI2O8_12760) yqhG 2464694..2465488 (+) 795 WP_015714249.1 YqhG family protein -
  ACI2O8_RS12765 (ACI2O8_12765) sinI 2465671..2465844 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ACI2O8_RS12770 (ACI2O8_12770) sinR 2465878..2466213 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ACI2O8_RS12775 (ACI2O8_12775) tasA 2466306..2467091 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  ACI2O8_RS12780 (ACI2O8_12780) sipW 2467155..2467727 (-) 573 WP_072692741.1 signal peptidase I SipW -
  ACI2O8_RS12785 (ACI2O8_12785) tapA 2467711..2468472 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  ACI2O8_RS12790 (ACI2O8_12790) yqzG 2468744..2469070 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ACI2O8_RS12795 (ACI2O8_12795) spoIITA 2469112..2469291 (-) 180 WP_029726723.1 YqzE family protein -
  ACI2O8_RS12800 (ACI2O8_12800) comGG 2469363..2469737 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  ACI2O8_RS12805 (ACI2O8_12805) comGF 2469738..2470121 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  ACI2O8_RS12810 (ACI2O8_12810) comGE 2470147..2470494 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=1072102 ACI2O8_RS12765 WP_003230187.1 2465671..2465844(+) (sinI) [Bacillus subtilis strain FJYA24]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1072102 ACI2O8_RS12765 WP_003230187.1 2465671..2465844(+) (sinI) [Bacillus subtilis strain FJYA24]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment