Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   ACI2O8_RS12805 Genome accession   NZ_CP173415
Coordinates   2469738..2470121 (-) Length   127 a.a.
NCBI ID   WP_029726721.1    Uniprot ID   -
Organism   Bacillus subtilis strain FJYA24     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2464738..2475121
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACI2O8_RS12765 (ACI2O8_12765) sinI 2465671..2465844 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ACI2O8_RS12770 (ACI2O8_12770) sinR 2465878..2466213 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ACI2O8_RS12775 (ACI2O8_12775) tasA 2466306..2467091 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  ACI2O8_RS12780 (ACI2O8_12780) sipW 2467155..2467727 (-) 573 WP_072692741.1 signal peptidase I SipW -
  ACI2O8_RS12785 (ACI2O8_12785) tapA 2467711..2468472 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  ACI2O8_RS12790 (ACI2O8_12790) yqzG 2468744..2469070 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ACI2O8_RS12795 (ACI2O8_12795) spoIITA 2469112..2469291 (-) 180 WP_029726723.1 YqzE family protein -
  ACI2O8_RS12800 (ACI2O8_12800) comGG 2469363..2469737 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  ACI2O8_RS12805 (ACI2O8_12805) comGF 2469738..2470121 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  ACI2O8_RS12810 (ACI2O8_12810) comGE 2470147..2470494 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  ACI2O8_RS12815 (ACI2O8_12815) comGD 2470478..2470909 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  ACI2O8_RS12820 (ACI2O8_12820) comGC 2470899..2471195 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  ACI2O8_RS12825 (ACI2O8_12825) comGB 2471209..2472246 (-) 1038 WP_029726718.1 comG operon protein ComGB Machinery gene
  ACI2O8_RS12830 (ACI2O8_12830) comGA 2472233..2473303 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  ACI2O8_RS12835 (ACI2O8_12835) - 2473516..2473713 (-) 198 WP_029726717.1 hypothetical protein -
  ACI2O8_RS12840 (ACI2O8_12840) corA 2473715..2474668 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14409.52 Da        Isoelectric Point: 5.8940

>NTDB_id=1072105 ACI2O8_RS12805 WP_029726721.1 2469738..2470121(-) (comGF) [Bacillus subtilis strain FJYA24]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENCVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=1072105 ACI2O8_RS12805 WP_029726721.1 2469738..2470121(-) (comGF) [Bacillus subtilis strain FJYA24]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATTGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

96.85

100

0.969


Multiple sequence alignment