Detailed information    

insolico Bioinformatically predicted

Overview


Name   pilL   Type   Machinery gene
Locus tag   ACIVJH_RS05525 Genome accession   NZ_CP173226
Coordinates   1032268..1032741 (+) Length   157 a.a.
NCBI ID   WP_211305724.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain NCTC 8375 [B 5025]     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1032811..1070806 1032268..1032741 flank 70


Gene organization within MGE regions


Location: 1032268..1070806
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACIVJH_RS05525 pilL 1032268..1032741 (+) 474 WP_211305724.1 PilX family type IV pilin Machinery gene
  ACIVJH_RS05530 - 1032811..1033119 (-) 309 WP_113852105.1 AzlD family protein -
  ACIVJH_RS05535 - 1033116..1033824 (-) 709 Protein_1067 AzlC family ABC transporter permease -
  ACIVJH_RS05540 dut 1033990..1034442 (+) 453 WP_113852107.1 dUTP diphosphatase -
  ACIVJH_RS05545 dapC 1034520..1035707 (+) 1188 WP_113852108.1 succinyldiaminopimelate transaminase -
  ACIVJH_RS05550 yaaA 1035863..1036642 (+) 780 WP_003687925.1 peroxide stress protein YaaA -
  ACIVJH_RS05565 - 1037172..1038365 (+) 1194 WP_033910493.1 phage integrase central domain-containing protein -
  ACIVJH_RS05570 - 1038721..1038990 (-) 270 WP_003687928.1 hypothetical protein -
  ACIVJH_RS05575 - 1039185..1039868 (-) 684 WP_003687929.1 DUF2786 domain-containing protein -
  ACIVJH_RS05580 - 1040149..1040415 (-) 267 Protein_1074 hypothetical protein -
  ACIVJH_RS05585 - 1040526..1040741 (-) 216 WP_003691538.1 hypothetical protein -
  ACIVJH_RS05590 - 1040793..1041284 (-) 492 WP_404376753.1 siphovirus Gp157 family protein -
  ACIVJH_RS05595 - 1041281..1041463 (-) 183 WP_003691535.1 hypothetical protein -
  ACIVJH_RS05600 - 1041603..1042289 (-) 687 WP_113852161.1 phage replication initiation protein, NGO0469 family -
  ACIVJH_RS05605 - 1042358..1042519 (-) 162 WP_003693867.1 hypothetical protein -
  ACIVJH_RS05610 - 1042516..1042791 (-) 276 WP_113852162.1 NGO1622 family putative holin -
  ACIVJH_RS05615 - 1042944..1043276 (-) 333 WP_003695500.1 hypothetical protein -
  ACIVJH_RS05620 - 1043889..1044107 (+) 219 WP_003691731.1 hypothetical protein -
  ACIVJH_RS05625 - 1044124..1044483 (-) 360 WP_003694117.1 hypothetical protein -
  ACIVJH_RS05630 - 1044484..1045023 (-) 540 WP_113852164.1 Panacea domain-containing protein -
  ACIVJH_RS05635 - 1045183..1045887 (-) 705 WP_003702453.1 helix-turn-helix transcriptional regulator -
  ACIVJH_RS05640 - 1046015..1046230 (+) 216 WP_223169978.1 helix-turn-helix transcriptional regulator -
  ACIVJH_RS05645 - 1046310..1046465 (+) 156 WP_003689578.1 hypothetical protein -
  ACIVJH_RS05650 - 1046442..1046630 (-) 189 WP_003691445.1 hypothetical protein -
  ACIVJH_RS05655 - 1046803..1047030 (+) 228 WP_003698261.1 helix-turn-helix domain-containing protein -
  ACIVJH_RS05660 - 1047148..1047615 (+) 468 WP_229692802.1 hypothetical protein -
  ACIVJH_RS05665 - 1047710..1048213 (+) 504 WP_010360005.1 hypothetical protein -
  ACIVJH_RS05670 - 1048210..1049568 (+) 1359 WP_003693467.1 DnaB-like helicase C-terminal domain-containing protein -
  ACIVJH_RS05675 - 1049585..1049836 (+) 252 WP_003693465.1 hypothetical protein -
  ACIVJH_RS05680 - 1049850..1050344 (+) 495 WP_003693463.1 DUF3310 domain-containing protein -
  ACIVJH_RS05685 - 1050806..1050955 (+) 150 WP_003692854.1 hypothetical protein -
  ACIVJH_RS05690 - 1050984..1051694 (+) 711 WP_020996901.1 RusA family crossover junction endodeoxyribonuclease -
  ACIVJH_RS05695 - 1051687..1051992 (+) 306 WP_003687981.1 nuclease domain-containing protein -
  ACIVJH_RS05700 - 1051989..1052372 (+) 384 WP_003690918.1 recombination protein NinB -
  ACIVJH_RS05705 - 1052363..1052881 (+) 519 WP_003693459.1 HNH endonuclease -
  ACIVJH_RS05710 - 1052946..1053368 (+) 423 WP_003690919.1 hypothetical protein -
  ACIVJH_RS05715 - 1053368..1053907 (+) 540 WP_003690920.1 hypothetical protein -
  ACIVJH_RS05720 - 1053888..1055162 (+) 1275 WP_047919159.1 PBSX family phage terminase large subunit -
  ACIVJH_RS05725 - 1055147..1057414 (+) 2268 WP_225577699.1 hypothetical protein -
  ACIVJH_RS05730 - 1057652..1058848 (+) 1197 WP_003693452.1 hypothetical protein -
  ACIVJH_RS05735 - 1058845..1066152 (+) 7308 WP_003698268.1 PLxRFG domain-containing protein -
  ACIVJH_RS05740 - 1066778..1068073 (+) 1296 WP_003693441.1 DUF4043 family protein -
  ACIVJH_RS05745 - 1068132..1068605 (+) 474 WP_113852114.1 hypothetical protein -
  ACIVJH_RS05750 - 1068611..1069096 (+) 486 WP_003693438.1 hypothetical protein -
  ACIVJH_RS05755 - 1069093..1069746 (+) 654 WP_227719074.1 hypothetical protein -
  ACIVJH_RS05760 - 1069769..1069918 (+) 150 WP_017146863.1 hypothetical protein -
  ACIVJH_RS05765 - 1069955..1070806 (-) 852 WP_003693432.1 Bro-N domain-containing protein -

Sequence


Protein


Download         Length: 157 a.a.        Molecular weight: 17472.27 Da        Isoelectric Point: 9.7225

>NTDB_id=1070870 ACIVJH_RS05525 WP_211305724.1 1032268..1032741(+) (pilL) [Neisseria gonorrhoeae strain NCTC 8375 [B 5025]]
MEQKGFTLIEMMIVVTILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDDNQIIKSKLEIFVSGYKM
NPKIAKKYSVSVAFANTEKPRAYRLVGVPKVGTGYTLSVWMNSVGDGYKCRDAASAQAYSETLSANTGCEAFSNRKK

Nucleotide


Download         Length: 474 bp        

>NTDB_id=1070870 ACIVJH_RS05525 WP_211305724.1 1032268..1032741(+) (pilL) [Neisseria gonorrhoeae strain NCTC 8375 [B 5025]]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCACGATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAGAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACGATAATCAGATCATCAAGAGCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTGGCATTTGCCAATACGGAAAAACCAAGGGCATACAGGTTGGTCGG
CGTTCCGAAGGTAGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCG
CTTCTGCCCAGGCCTATTCGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilL Neisseria gonorrhoeae MS11

92.357

100

0.924

  pilX Neisseria meningitidis 8013

87.898

100

0.879


Multiple sequence alignment