Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ACFVP7_RS13850 Genome accession   NZ_CP172606
Coordinates   2630122..2630295 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus sp. SG20033     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2625122..2635295
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACFVP7_RS13835 (ACFVP7_13835) gcvT 2625921..2627009 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  ACFVP7_RS13840 (ACFVP7_13840) - 2627451..2629124 (+) 1674 WP_153529794.1 DEAD/DEAH box helicase -
  ACFVP7_RS13845 (ACFVP7_13845) - 2629145..2629939 (+) 795 WP_003230200.1 YqhG family protein -
  ACFVP7_RS13850 (ACFVP7_13850) sinI 2630122..2630295 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ACFVP7_RS13855 (ACFVP7_13855) sinR 2630329..2630664 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ACFVP7_RS13860 (ACFVP7_13860) tasA 2630757..2631542 (-) 786 WP_072175550.1 biofilm matrix protein TasA -
  ACFVP7_RS13865 (ACFVP7_13865) sipW 2631606..2632178 (-) 573 WP_003230181.1 signal peptidase I SipW -
  ACFVP7_RS13870 (ACFVP7_13870) tapA 2632162..2632923 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  ACFVP7_RS13875 (ACFVP7_13875) - 2633195..2633521 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ACFVP7_RS13880 (ACFVP7_13880) - 2633563..2633742 (-) 180 WP_029726723.1 YqzE family protein -
  ACFVP7_RS13885 (ACFVP7_13885) comGG 2633814..2634188 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  ACFVP7_RS13890 (ACFVP7_13890) comGF 2634189..2634572 (-) 384 WP_046160582.1 ComG operon protein ComGF Machinery gene
  ACFVP7_RS13895 (ACFVP7_13895) comGE 2634598..2634945 (-) 348 WP_046381178.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=1068304 ACFVP7_RS13850 WP_003230187.1 2630122..2630295(+) (sinI) [Bacillus sp. SG20033]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1068304 ACFVP7_RS13850 WP_003230187.1 2630122..2630295(+) (sinI) [Bacillus sp. SG20033]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment