Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACFMPA_RS16355 Genome accession   NZ_CP172605
Coordinates   3152961..3153101 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus sp. SG20032     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3147961..3158101
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACFMPA_RS16330 (ACFMPA_16330) - 3148303..3148683 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  ACFMPA_RS16335 (ACFMPA_16335) comA 3148702..3149346 (-) 645 WP_048654909.1 two-component system response regulator ComA Regulator
  ACFMPA_RS16340 (ACFMPA_16340) comP 3149427..3151727 (-) 2301 WP_088300729.1 histidine kinase Regulator
  ACFMPA_RS16345 (ACFMPA_16345) comX 3151739..3151903 (-) 165 WP_015384519.1 competence pheromone ComX -
  ACFMPA_RS16350 (ACFMPA_16350) - 3151916..3152776 (-) 861 WP_041850585.1 polyprenyl synthetase family protein -
  ACFMPA_RS16355 (ACFMPA_16355) degQ 3152961..3153101 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ACFMPA_RS16360 (ACFMPA_16360) - 3153323..3153385 (+) 63 Protein_3156 hypothetical protein -
  ACFMPA_RS16365 (ACFMPA_16365) - 3153563..3153931 (+) 369 WP_050258610.1 hypothetical protein -
  ACFMPA_RS16370 (ACFMPA_16370) pdeH 3153907..3155136 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  ACFMPA_RS16375 (ACFMPA_16375) - 3155273..3156745 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  ACFMPA_RS16380 (ACFMPA_16380) - 3156761..3157312 (-) 552 WP_015714627.1 cysteine hydrolase family protein -
  ACFMPA_RS16385 (ACFMPA_16385) - 3157409..3157807 (-) 399 WP_015251331.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=1068248 ACFMPA_RS16355 WP_003220708.1 3152961..3153101(-) (degQ) [Bacillus sp. SG20032]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1068248 ACFMPA_RS16355 WP_003220708.1 3152961..3153101(-) (degQ) [Bacillus sp. SG20032]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment