Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACHGMI_RS18390 Genome accession   NZ_CP172417
Coordinates   3354857..3354997 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain AKPS2     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3349857..3359997
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACHGMI_RS18365 - 3350134..3350514 (-) 381 WP_041052848.1 hotdog fold thioesterase -
  ACHGMI_RS18370 comA 3350533..3351177 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ACHGMI_RS18375 comP 3351258..3353570 (-) 2313 WP_014480703.1 sensor histidine kinase Regulator
  ACHGMI_RS18380 comX 3353586..3353807 (-) 222 WP_014480704.1 competence pheromone ComX -
  ACHGMI_RS18385 - 3353809..3354672 (-) 864 WP_014480705.1 polyprenyl synthetase family protein -
  ACHGMI_RS18390 degQ 3354857..3354997 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ACHGMI_RS18395 - 3355219..3355281 (+) 63 Protein_3560 hypothetical protein -
  ACHGMI_RS18400 - 3355459..3355827 (+) 369 WP_017695529.1 hypothetical protein -
  ACHGMI_RS18405 pdeH 3355803..3357032 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  ACHGMI_RS18410 - 3357169..3358641 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  ACHGMI_RS18415 - 3358657..3359208 (-) 552 WP_014480709.1 cysteine hydrolase family protein -
  ACHGMI_RS18420 - 3359305..3359703 (-) 399 WP_017695530.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=1067611 ACHGMI_RS18390 WP_003220708.1 3354857..3354997(-) (degQ) [Bacillus subtilis strain AKPS2]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1067611 ACHGMI_RS18390 WP_003220708.1 3354857..3354997(-) (degQ) [Bacillus subtilis strain AKPS2]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment