Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   ACHGMI_RS14130 Genome accession   NZ_CP172417
Coordinates   2584954..2585127 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain AKPS2     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2579954..2590127
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACHGMI_RS14085 comGE 2580311..2580658 (+) 348 WP_017696195.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACHGMI_RS14090 comGF 2580684..2581067 (+) 384 WP_017696196.1 ComG operon protein ComGF Machinery gene
  ACHGMI_RS14095 comGG 2581068..2581442 (+) 375 WP_017696197.1 ComG operon protein ComGG Machinery gene
  ACHGMI_RS14100 spoIITA 2581513..2581692 (+) 180 WP_014480252.1 YqzE family protein -
  ACHGMI_RS14105 yqzG 2581734..2582060 (-) 327 WP_026113671.1 YqzG/YhdC family protein -
  ACHGMI_RS14110 tapA 2582331..2583086 (+) 756 WP_017696199.1 amyloid fiber anchoring/assembly protein TapA -
  ACHGMI_RS14115 sipW 2583070..2583642 (+) 573 WP_080031082.1 signal peptidase I SipW -
  ACHGMI_RS14120 tasA 2583707..2584492 (+) 786 WP_017696201.1 biofilm matrix protein TasA -
  ACHGMI_RS14125 sinR 2584585..2584920 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ACHGMI_RS14130 sinI 2584954..2585127 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  ACHGMI_RS14135 yqhG 2585310..2586104 (-) 795 WP_017696202.1 YqhG family protein -
  ACHGMI_RS14140 hepAA 2586125..2587798 (-) 1674 WP_017696203.1 DEAD/DEAH box helicase -
  ACHGMI_RS14145 gcvT 2588239..2589327 (+) 1089 WP_017696204.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=1067594 ACHGMI_RS14130 WP_003230187.1 2584954..2585127(-) (sinI) [Bacillus subtilis strain AKPS2]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1067594 ACHGMI_RS14130 WP_003230187.1 2584954..2585127(-) (sinI) [Bacillus subtilis strain AKPS2]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment