Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   ACHGMI_RS14090 Genome accession   NZ_CP172417
Coordinates   2580684..2581067 (+) Length   127 a.a.
NCBI ID   WP_017696196.1    Uniprot ID   -
Organism   Bacillus subtilis strain AKPS2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2575684..2586067
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACHGMI_RS14060 corA 2576139..2577092 (+) 954 WP_017696189.1 magnesium transporter CorA -
  ACHGMI_RS14065 comGA 2577502..2578572 (+) 1071 WP_017696192.1 competence protein ComGA Machinery gene
  ACHGMI_RS14070 comGB 2578559..2579596 (+) 1038 WP_017696193.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACHGMI_RS14075 comGC 2579610..2579906 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  ACHGMI_RS14080 comGD 2579896..2580327 (+) 432 WP_017696194.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACHGMI_RS14085 comGE 2580311..2580658 (+) 348 WP_017696195.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACHGMI_RS14090 comGF 2580684..2581067 (+) 384 WP_017696196.1 ComG operon protein ComGF Machinery gene
  ACHGMI_RS14095 comGG 2581068..2581442 (+) 375 WP_017696197.1 ComG operon protein ComGG Machinery gene
  ACHGMI_RS14100 spoIITA 2581513..2581692 (+) 180 WP_014480252.1 YqzE family protein -
  ACHGMI_RS14105 yqzG 2581734..2582060 (-) 327 WP_026113671.1 YqzG/YhdC family protein -
  ACHGMI_RS14110 tapA 2582331..2583086 (+) 756 WP_017696199.1 amyloid fiber anchoring/assembly protein TapA -
  ACHGMI_RS14115 sipW 2583070..2583642 (+) 573 WP_080031082.1 signal peptidase I SipW -
  ACHGMI_RS14120 tasA 2583707..2584492 (+) 786 WP_017696201.1 biofilm matrix protein TasA -
  ACHGMI_RS14125 sinR 2584585..2584920 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ACHGMI_RS14130 sinI 2584954..2585127 (-) 174 WP_003230187.1 anti-repressor SinI Regulator

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14291.41 Da        Isoelectric Point: 6.4831

>NTDB_id=1067591 ACHGMI_RS14090 WP_017696196.1 2580684..2581067(+) (comGF) [Bacillus subtilis strain AKPS2]
MLISGSLATIFHLFLSRQQEHGGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADFVNGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=1067591 ACHGMI_RS14090 WP_017696196.1 2580684..2581067(+) (comGF) [Bacillus subtilis strain AKPS2]
TTGCTCATATCAGGATCGTTAGCGACGATTTTCCATCTGTTTTTATCTCGACAGCAGGAGCATGGCGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAAGACATCCGTTTTGACATTTATCATTCAATGATCAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGTAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

96.063

100

0.961


Multiple sequence alignment