Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACH2FV_RS15010 Genome accession   NZ_CP172339
Coordinates   2882124..2882264 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus safensis subsp. safensis strain KGU003     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2877124..2887264
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACH2FV_RS14985 (ACH2FV_14985) - 2877390..2877779 (-) 390 WP_024423321.1 hotdog fold thioesterase -
  ACH2FV_RS14990 (ACH2FV_14990) comA 2877803..2878444 (-) 642 WP_024423322.1 response regulator transcription factor Regulator
  ACH2FV_RS14995 (ACH2FV_14995) comP 2878525..2880837 (-) 2313 WP_332284798.1 ATP-binding protein Regulator
  ACH2FV_RS15000 (ACH2FV_15000) comX 2880891..2881061 (-) 171 WP_395894051.1 competence pheromone ComX -
  ACH2FV_RS15005 (ACH2FV_15005) - 2881058..2881972 (-) 915 WP_395894052.1 polyprenyl synthetase family protein -
  ACH2FV_RS15010 (ACH2FV_15010) degQ 2882124..2882264 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  ACH2FV_RS15015 (ACH2FV_15015) - 2882770..2883126 (+) 357 WP_083703979.1 inner spore coat protein -
  ACH2FV_RS15020 (ACH2FV_15020) - 2883162..2884388 (-) 1227 WP_041107632.1 EAL and HDOD domain-containing protein -
  ACH2FV_RS15025 (ACH2FV_15025) - 2884526..2885998 (-) 1473 WP_024423327.1 nicotinate phosphoribosyltransferase -
  ACH2FV_RS15030 (ACH2FV_15030) - 2886016..2886567 (-) 552 WP_024425949.1 cysteine hydrolase family protein -
  ACH2FV_RS15035 (ACH2FV_15035) - 2886628..2887035 (-) 408 WP_395894053.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=1066528 ACH2FV_RS15010 WP_003213123.1 2882124..2882264(-) (degQ) [Bacillus safensis subsp. safensis strain KGU003]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1066528 ACH2FV_RS15010 WP_003213123.1 2882124..2882264(-) (degQ) [Bacillus safensis subsp. safensis strain KGU003]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATCAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment