Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACHKST_RS15135 Genome accession   NZ_CP172011
Coordinates   3049027..3049167 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain Bv.g1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3044027..3054167
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACHKST_RS15115 - 3044324..3044707 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  ACHKST_RS15120 comA 3044729..3045373 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  ACHKST_RS15125 comP 3045454..3047757 (-) 2304 WP_101562386.1 histidine kinase Regulator
  ACHKST_RS15130 comQ 3047910..3048842 (-) 933 WP_025650217.1 class 1 isoprenoid biosynthesis enzyme Regulator
  ACHKST_RS15135 degQ 3049027..3049167 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  ACHKST_RS15140 - 3049632..3049973 (+) 342 WP_014305721.1 hypothetical protein -
  ACHKST_RS15145 - 3049980..3051200 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  ACHKST_RS15150 - 3051330..3052796 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  ACHKST_RS15155 - 3052814..3053365 (-) 552 WP_025853916.1 cysteine hydrolase family protein -
  ACHKST_RS15160 - 3053462..3053860 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1064858 ACHKST_RS15135 WP_003152043.1 3049027..3049167(-) (degQ) [Bacillus velezensis strain Bv.g1]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1064858 ACHKST_RS15135 WP_003152043.1 3049027..3049167(-) (degQ) [Bacillus velezensis strain Bv.g1]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment