Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   ACHKST_RS11925 Genome accession   NZ_CP172011
Coordinates   2454094..2454267 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain Bv.g1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2449094..2459267
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACHKST_RS11910 gcvT 2449911..2451011 (-) 1101 WP_071391617.1 glycine cleavage system aminomethyltransferase GcvT -
  ACHKST_RS11915 - 2451435..2453105 (+) 1671 WP_101562269.1 DEAD/DEAH box helicase -
  ACHKST_RS11920 - 2453123..2453917 (+) 795 WP_071391615.1 YqhG family protein -
  ACHKST_RS11925 sinI 2454094..2454267 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACHKST_RS11930 sinR 2454301..2454636 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACHKST_RS11935 tasA 2454684..2455469 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  ACHKST_RS11940 sipW 2455533..2456117 (-) 585 WP_101562270.1 signal peptidase I SipW -
  ACHKST_RS11945 tapA 2456089..2456760 (-) 672 WP_101562271.1 amyloid fiber anchoring/assembly protein TapA -
  ACHKST_RS11950 - 2457019..2457348 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  ACHKST_RS11955 - 2457388..2457567 (-) 180 WP_003153093.1 YqzE family protein -
  ACHKST_RS11960 comGG 2457624..2458001 (-) 378 WP_101562272.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACHKST_RS11965 comGF 2458002..2458502 (-) 501 WP_014305411.1 competence type IV pilus minor pilin ComGF -
  ACHKST_RS11970 comGE 2458411..2458725 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACHKST_RS11975 comGD 2458709..2459146 (-) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=1064835 ACHKST_RS11925 WP_003153105.1 2454094..2454267(+) (sinI) [Bacillus velezensis strain Bv.g1]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1064835 ACHKST_RS11925 WP_003153105.1 2454094..2454267(+) (sinI) [Bacillus velezensis strain Bv.g1]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702

Multiple sequence alignment