Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   ACHKST_RS11970 Genome accession   NZ_CP172011
Coordinates   2458411..2458725 (-) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus velezensis strain Bv.g1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2453411..2463725
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACHKST_RS11925 sinI 2454094..2454267 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACHKST_RS11930 sinR 2454301..2454636 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACHKST_RS11935 tasA 2454684..2455469 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  ACHKST_RS11940 sipW 2455533..2456117 (-) 585 WP_101562270.1 signal peptidase I SipW -
  ACHKST_RS11945 tapA 2456089..2456760 (-) 672 WP_101562271.1 amyloid fiber anchoring/assembly protein TapA -
  ACHKST_RS11950 - 2457019..2457348 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  ACHKST_RS11955 - 2457388..2457567 (-) 180 WP_003153093.1 YqzE family protein -
  ACHKST_RS11960 comGG 2457624..2458001 (-) 378 WP_101562272.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACHKST_RS11965 comGF 2458002..2458502 (-) 501 WP_014305411.1 competence type IV pilus minor pilin ComGF -
  ACHKST_RS11970 comGE 2458411..2458725 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACHKST_RS11975 comGD 2458709..2459146 (-) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACHKST_RS11980 comGC 2459136..2459444 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  ACHKST_RS11985 comGB 2459449..2460486 (-) 1038 WP_063174751.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACHKST_RS11990 comGA 2460473..2461543 (-) 1071 WP_070082113.1 competence type IV pilus ATPase ComGA Machinery gene
  ACHKST_RS11995 - 2461734..2462684 (-) 951 WP_071391609.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=1064838 ACHKST_RS11970 WP_015388003.1 2458411..2458725(-) (comGE) [Bacillus velezensis strain Bv.g1]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=1064838 ACHKST_RS11970 WP_015388003.1 2458411..2458725(-) (comGE) [Bacillus velezensis strain Bv.g1]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAGC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGCGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGTCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481


Multiple sequence alignment