Detailed information    

insolico Bioinformatically predicted

Overview

Name   phrC   Type   Regulator
Locus tag   ACHKST_RS01990 Genome accession   NZ_CP172011
Coordinates   388040..388159 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain Bv.g1     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context

Location: 383040..393159
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACHKST_RS01975 - 384652..385335 (+) 684 WP_014416901.1 response regulator transcription factor -
  ACHKST_RS01980 - 385322..386755 (+) 1434 WP_187297950.1 HAMP domain-containing sensor histidine kinase -
  ACHKST_RS01985 rapC 386908..388056 (+) 1149 WP_003156336.1 Rap family tetratricopeptide repeat protein Regulator
  ACHKST_RS01990 phrC 388040..388159 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  ACHKST_RS01995 - 388310..388420 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  ACHKST_RS02000 - 388500..389864 (-) 1365 WP_101562697.1 aspartate kinase -
  ACHKST_RS02005 ceuB 390279..391232 (+) 954 WP_003156332.1 ABC transporter permease Machinery gene
  ACHKST_RS02010 - 391222..392169 (+) 948 WP_007410274.1 iron chelate uptake ABC transporter family permease subunit -
  ACHKST_RS02015 - 392163..392921 (+) 759 WP_071392129.1 ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=1064805 ACHKST_RS01990 WP_003156334.1 388040..388159(+) (phrC) [Bacillus velezensis strain Bv.g1]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=1064805 ACHKST_RS01990 WP_003156334.1 388040..388159(+) (phrC) [Bacillus velezensis strain Bv.g1]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA

Domains

Predicted by InterproScan.

Rap-phr extracellular signalling (PhrC_PhrF)

(3-39)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718

Multiple sequence alignment