Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACHD8M_RS15770 Genome accession   NZ_CP171807
Coordinates   3123743..3123883 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain BRI3     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3118743..3128883
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACHD8M_RS15745 - 3119080..3119463 (-) 384 WP_014418761.1 hotdog fold thioesterase -
  ACHD8M_RS15750 comA 3119485..3120129 (-) 645 WP_014418762.1 response regulator transcription factor Regulator
  ACHD8M_RS15755 comP 3120210..3122504 (-) 2295 WP_159354531.1 histidine kinase Regulator
  ACHD8M_RS15760 comX 3122516..3122680 (-) 165 WP_007613432.1 competence pheromone ComX -
  ACHD8M_RS15765 - 3122680..3123591 (-) 912 WP_022553710.1 polyprenyl synthetase family protein -
  ACHD8M_RS15770 degQ 3123743..3123883 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  ACHD8M_RS15775 - 3124348..3124689 (+) 342 WP_021495366.1 hypothetical protein -
  ACHD8M_RS15780 - 3124696..3125919 (-) 1224 WP_007613436.1 EAL and HDOD domain-containing protein -
  ACHD8M_RS15785 - 3126049..3127515 (-) 1467 WP_159354532.1 nicotinate phosphoribosyltransferase -
  ACHD8M_RS15790 - 3127533..3128084 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  ACHD8M_RS15795 - 3128181..3128579 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1064363 ACHD8M_RS15770 WP_003152043.1 3123743..3123883(-) (degQ) [Bacillus velezensis strain BRI3]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1064363 ACHD8M_RS15770 WP_003152043.1 3123743..3123883(-) (degQ) [Bacillus velezensis strain BRI3]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment