Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | ACG3JH_RS06945 | Genome accession | NZ_CP171731 |
| Coordinates | 1372141..1372668 (-) | Length | 175 a.a. |
| NCBI ID | WP_013794415.1 | Uniprot ID | - |
| Organism | Streptococcus parauberis strain DB-M1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1322981..1381298 | 1372141..1372668 | within | 0 |
Gene organization within MGE regions
Location: 1322981..1381298
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACG3JH_RS06635 (ACG3JH_06635) | - | 1322981..1324741 (-) | 1761 | WP_045406937.1 | LPXTG cell wall anchor domain-containing protein | - |
| ACG3JH_RS06640 (ACG3JH_06640) | - | 1325122..1326627 (+) | 1506 | WP_013794389.1 | helix-turn-helix domain-containing protein | - |
| ACG3JH_RS06645 (ACG3JH_06645) | hslO | 1326655..1327527 (+) | 873 | WP_003108619.1 | Hsp33 family molecular chaperone HslO | - |
| ACG3JH_RS06650 (ACG3JH_06650) | dusB | 1327514..1328491 (+) | 978 | WP_013794390.1 | tRNA dihydrouridine synthase DusB | - |
| ACG3JH_RS06655 (ACG3JH_06655) | - | 1328509..1329150 (+) | 642 | WP_003102694.1 | deoxynucleoside kinase | - |
| ACG3JH_RS06660 (ACG3JH_06660) | - | 1329233..1330036 (-) | 804 | WP_003104647.1 | ABC transporter ATP-binding protein | - |
| ACG3JH_RS06665 (ACG3JH_06665) | - | 1330045..1330929 (-) | 885 | WP_013794392.1 | ABC transporter permease | - |
| ACG3JH_RS06670 (ACG3JH_06670) | - | 1330964..1331950 (-) | 987 | WP_003108623.1 | ABC transporter substrate-binding protein | - |
| ACG3JH_RS06675 (ACG3JH_06675) | - | 1331962..1332933 (-) | 972 | WP_003108625.1 | ABC transporter substrate-binding protein | - |
| ACG3JH_RS06680 (ACG3JH_06680) | ssbA | 1333402..1333800 (-) | 399 | WP_003105619.1 | single-stranded DNA-binding protein | Machinery gene |
| ACG3JH_RS06685 (ACG3JH_06685) | ytpR | 1333938..1334564 (-) | 627 | WP_013794394.1 | YtpR family tRNA-binding protein | - |
| ACG3JH_RS06690 (ACG3JH_06690) | - | 1334580..1334897 (-) | 318 | WP_003103432.1 | thioredoxin family protein | - |
| ACG3JH_RS06695 (ACG3JH_06695) | - | 1334897..1335178 (-) | 282 | WP_003102775.1 | DUF4651 domain-containing protein | - |
| ACG3JH_RS06700 (ACG3JH_06700) | pepA | 1335541..1336608 (+) | 1068 | WP_003105090.1 | glutamyl aminopeptidase | - |
| ACG3JH_RS06705 (ACG3JH_06705) | proC | 1336620..1337390 (+) | 771 | WP_003104671.1 | pyrroline-5-carboxylate reductase | - |
| ACG3JH_RS06710 (ACG3JH_06710) | - | 1337407..1338060 (-) | 654 | WP_013794395.1 | CPBP family intramembrane glutamic endopeptidase | - |
| ACG3JH_RS06715 (ACG3JH_06715) | - | 1338069..1338521 (-) | 453 | WP_003108634.1 | hypothetical protein | - |
| ACG3JH_RS06720 (ACG3JH_06720) | - | 1338514..1338726 (-) | 213 | WP_003108636.1 | helix-turn-helix transcriptional regulator | - |
| ACG3JH_RS06725 (ACG3JH_06725) | - | 1338837..1340030 (-) | 1194 | WP_003108638.1 | acetate kinase | - |
| ACG3JH_RS06730 (ACG3JH_06730) | comYH | 1340086..1341042 (-) | 957 | WP_003103712.1 | class I SAM-dependent methyltransferase | Machinery gene |
| ACG3JH_RS06735 (ACG3JH_06735) | comGG | 1341149..1341595 (-) | 447 | WP_238570152.1 | competence type IV pilus minor pilin ComGG | - |
| ACG3JH_RS06740 (ACG3JH_06740) | comGF | 1341624..1342061 (-) | 438 | WP_003102915.1 | competence type IV pilus minor pilin ComGF | - |
| ACG3JH_RS06745 (ACG3JH_06745) | comGE | 1342039..1342338 (-) | 300 | WP_259966510.1 | competence type IV pilus minor pilin ComGE | - |
| ACG3JH_RS06750 (ACG3JH_06750) | comGD | 1342310..1342717 (-) | 408 | WP_243619590.1 | competence type IV pilus minor pilin ComGD | - |
| ACG3JH_RS06755 (ACG3JH_06755) | comYC | 1342707..1343027 (-) | 321 | WP_013794397.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| ACG3JH_RS06760 (ACG3JH_06760) | - | 1343680..1344405 (-) | 726 | WP_013794398.1 | peptidoglycan amidohydrolase family protein | - |
| ACG3JH_RS06765 (ACG3JH_06765) | - | 1344398..1344862 (-) | 465 | WP_013794399.1 | phage holin family protein | - |
| ACG3JH_RS06770 (ACG3JH_06770) | - | 1344866..1345015 (-) | 150 | WP_259966511.1 | hypothetical protein | - |
| ACG3JH_RS06775 (ACG3JH_06775) | - | 1345078..1345416 (-) | 339 | WP_013794400.1 | DUF1366 domain-containing protein | - |
| ACG3JH_RS06780 (ACG3JH_06780) | - | 1345465..1347321 (-) | 1857 | WP_013794401.1 | DUF859 family phage minor structural protein | - |
| ACG3JH_RS06785 (ACG3JH_06785) | - | 1347331..1350876 (-) | 3546 | WP_259966512.1 | phage tail protein | - |
| ACG3JH_RS06790 (ACG3JH_06790) | - | 1350876..1352321 (-) | 1446 | WP_013794404.1 | distal tail protein Dit | - |
| ACG3JH_RS06795 (ACG3JH_06795) | - | 1352318..1356124 (-) | 3807 | WP_013794405.1 | tape measure protein | - |
| ACG3JH_RS06800 (ACG3JH_06800) | - | 1356144..1356731 (-) | 588 | WP_041828613.1 | Gp15 family bacteriophage protein | - |
| ACG3JH_RS06805 (ACG3JH_06805) | - | 1356734..1357132 (-) | 399 | WP_070030361.1 | hypothetical protein | - |
| ACG3JH_RS06810 (ACG3JH_06810) | - | 1357157..1357612 (-) | 456 | WP_041828614.1 | phage tail tube protein | - |
| ACG3JH_RS06815 (ACG3JH_06815) | - | 1357615..1358022 (-) | 408 | WP_003108657.1 | minor capsid protein | - |
| ACG3JH_RS06820 (ACG3JH_06820) | - | 1358023..1358379 (-) | 357 | WP_003108659.1 | minor capsid protein | - |
| ACG3JH_RS06825 (ACG3JH_06825) | - | 1358379..1358705 (-) | 327 | WP_041828616.1 | putative minor capsid protein | - |
| ACG3JH_RS06830 (ACG3JH_06830) | - | 1358695..1359084 (-) | 390 | WP_013794407.1 | hypothetical protein | - |
| ACG3JH_RS06835 (ACG3JH_06835) | - | 1359125..1359376 (-) | 252 | WP_003108665.1 | hypothetical protein | - |
| ACG3JH_RS06840 (ACG3JH_06840) | - | 1359388..1360272 (-) | 885 | WP_003108667.1 | hypothetical protein | - |
| ACG3JH_RS06845 (ACG3JH_06845) | - | 1360295..1360873 (-) | 579 | WP_013794408.1 | phage scaffolding protein | - |
| ACG3JH_RS06850 (ACG3JH_06850) | - | 1361009..1362178 (-) | 1170 | WP_259966513.1 | phage minor capsid protein | - |
| ACG3JH_RS06855 (ACG3JH_06855) | - | 1362178..1363746 (-) | 1569 | WP_259966514.1 | phage portal protein | - |
| ACG3JH_RS06860 (ACG3JH_06860) | - | 1363758..1365068 (-) | 1311 | WP_013794411.1 | PBSX family phage terminase large subunit | - |
| ACG3JH_RS06865 (ACG3JH_06865) | - | 1365065..1365511 (-) | 447 | WP_259966515.1 | stress-induced protein | - |
| ACG3JH_RS06870 (ACG3JH_06870) | - | 1365643..1366458 (-) | 816 | WP_013794412.1 | hypothetical protein | - |
| ACG3JH_RS06875 (ACG3JH_06875) | - | 1366462..1366788 (-) | 327 | WP_041828618.1 | hypothetical protein | - |
| ACG3JH_RS06880 (ACG3JH_06880) | - | 1366832..1367932 (-) | 1101 | WP_013794413.1 | DUF4417 domain-containing protein | - |
| ACG3JH_RS06885 (ACG3JH_06885) | - | 1368052..1368438 (-) | 387 | WP_041828619.1 | hypothetical protein | - |
| ACG3JH_RS06890 (ACG3JH_06890) | - | 1368425..1368604 (-) | 180 | WP_041828620.1 | hypothetical protein | - |
| ACG3JH_RS06895 (ACG3JH_06895) | - | 1368682..1368939 (-) | 258 | WP_259966516.1 | hypothetical protein | - |
| ACG3JH_RS06900 (ACG3JH_06900) | - | 1368936..1369154 (-) | 219 | WP_041828623.1 | hypothetical protein | - |
| ACG3JH_RS06905 (ACG3JH_06905) | - | 1369147..1369548 (-) | 402 | WP_041828624.1 | endodeoxyribonuclease RusA | - |
| ACG3JH_RS06910 (ACG3JH_06910) | - | 1369538..1370083 (-) | 546 | WP_013794414.1 | DUF1642 domain-containing protein | - |
| ACG3JH_RS06915 (ACG3JH_06915) | - | 1370073..1370315 (-) | 243 | WP_041828626.1 | hypothetical protein | - |
| ACG3JH_RS06920 (ACG3JH_06920) | - | 1370367..1370540 (-) | 174 | WP_259966517.1 | hypothetical protein | - |
| ACG3JH_RS06925 (ACG3JH_06925) | - | 1370543..1370728 (-) | 186 | WP_041828628.1 | hypothetical protein | - |
| ACG3JH_RS06930 (ACG3JH_06930) | - | 1370728..1371054 (-) | 327 | WP_003108696.1 | DUF1372 family protein | - |
| ACG3JH_RS06935 (ACG3JH_06935) | - | 1371397..1371645 (-) | 249 | WP_041828629.1 | hypothetical protein | - |
| ACG3JH_RS06940 (ACG3JH_06940) | - | 1371638..1372126 (-) | 489 | WP_003108699.1 | helix-turn-helix domain-containing protein | - |
| ACG3JH_RS06945 (ACG3JH_06945) | ssbA | 1372141..1372668 (-) | 528 | WP_013794415.1 | single-stranded DNA-binding protein | Machinery gene |
| ACG3JH_RS06950 (ACG3JH_06950) | - | 1372661..1373023 (-) | 363 | WP_080560929.1 | helix-turn-helix transcriptional regulator | - |
| ACG3JH_RS06955 (ACG3JH_06955) | - | 1373020..1373553 (-) | 534 | WP_041828630.1 | MazG-like family protein | - |
| ACG3JH_RS06960 (ACG3JH_06960) | - | 1373555..1374586 (-) | 1032 | WP_013794416.1 | DUF1351 domain-containing protein | - |
| ACG3JH_RS06965 (ACG3JH_06965) | - | 1374590..1375261 (-) | 672 | WP_080560930.1 | ERF family protein | - |
| ACG3JH_RS06970 (ACG3JH_06970) | - | 1375331..1375609 (-) | 279 | WP_041828632.1 | hypothetical protein | - |
| ACG3JH_RS06975 (ACG3JH_06975) | - | 1375611..1376564 (-) | 954 | WP_151191588.1 | phage replisome organizer N-terminal domain-containing protein | - |
| ACG3JH_RS06980 (ACG3JH_06980) | - | 1376561..1376752 (-) | 192 | WP_003108723.1 | hypothetical protein | - |
| ACG3JH_RS06985 (ACG3JH_06985) | - | 1376827..1377009 (-) | 183 | WP_003108726.1 | hypothetical protein | - |
| ACG3JH_RS06990 (ACG3JH_06990) | - | 1377046..1377249 (-) | 204 | WP_003108729.1 | helix-turn-helix domain-containing protein | - |
| ACG3JH_RS06995 (ACG3JH_06995) | - | 1377518..1378207 (+) | 690 | WP_013794418.1 | LexA family transcriptional regulator | - |
| ACG3JH_RS07000 (ACG3JH_07000) | - | 1378221..1378394 (+) | 174 | WP_192813189.1 | hypothetical protein | - |
| ACG3JH_RS07005 (ACG3JH_07005) | - | 1378396..1378986 (+) | 591 | WP_013794419.1 | hypothetical protein | - |
| ACG3JH_RS07010 (ACG3JH_07010) | - | 1379012..1379419 (+) | 408 | WP_041828634.1 | hypothetical protein | - |
| ACG3JH_RS07015 (ACG3JH_07015) | - | 1379424..1379741 (+) | 318 | WP_041828635.1 | hypothetical protein | - |
| ACG3JH_RS07020 (ACG3JH_07020) | - | 1379862..1381298 (+) | 1437 | WP_003108747.1 | recombinase family protein | - |
Sequence
Protein
Download Length: 175 a.a. Molecular weight: 19991.85 Da Isoelectric Point: 4.7079
>NTDB_id=1063735 ACG3JH_RS06945 WP_013794415.1 1372141..1372668(-) (ssbA) [Streptococcus parauberis strain DB-M1]
MINNVVLVGRLTKDAELRYTPSQVAVATFTLAVNRRIKEQNGEREADFINCVIWRDPAVNLEKWTNKGSLIGITGRINTR
NYENQQGQKVYVTEVIADNFQLLESRKDNNQGTPQNNQGYQQPQNNNQQPQNNYQQNNQGYQQTNNQGFNQGQQGSFFDG
MTTNPMDISDDDLPF
MINNVVLVGRLTKDAELRYTPSQVAVATFTLAVNRRIKEQNGEREADFINCVIWRDPAVNLEKWTNKGSLIGITGRINTR
NYENQQGQKVYVTEVIADNFQLLESRKDNNQGTPQNNQGYQQPQNNNQQPQNNYQQNNQGYQQTNNQGFNQGQQGSFFDG
MTTNPMDISDDDLPF
Nucleotide
Download Length: 528 bp
>NTDB_id=1063735 ACG3JH_RS06945 WP_013794415.1 1372141..1372668(-) (ssbA) [Streptococcus parauberis strain DB-M1]
ATGATTAATAATGTTGTTTTAGTTGGTCGATTGACCAAGGATGCAGAGTTGCGATATACACCAAGTCAGGTAGCAGTTGC
AACTTTCACATTGGCGGTTAATCGTCGAATTAAAGAGCAAAATGGTGAACGTGAGGCAGACTTTATCAATTGTGTCATTT
GGAGAGATCCTGCTGTCAATCTTGAAAAATGGACTAACAAAGGATCACTAATTGGTATCACAGGCAGAATTAATACTAGA
AATTATGAAAACCAACAAGGTCAGAAAGTCTATGTAACTGAGGTTATTGCTGACAATTTCCAGTTACTAGAAAGTCGCAA
GGATAATAACCAAGGGACACCTCAAAATAACCAAGGTTATCAACAGCCTCAGAATAATAACCAACAACCTCAAAATAATT
ATCAACAAAATAACCAAGGTTATCAACAAACAAACAATCAAGGGTTTAATCAAGGTCAGCAAGGAAGTTTCTTTGATGGC
ATGACTACAAATCCAATGGATATCAGTGATGACGATTTGCCATTCTAA
ATGATTAATAATGTTGTTTTAGTTGGTCGATTGACCAAGGATGCAGAGTTGCGATATACACCAAGTCAGGTAGCAGTTGC
AACTTTCACATTGGCGGTTAATCGTCGAATTAAAGAGCAAAATGGTGAACGTGAGGCAGACTTTATCAATTGTGTCATTT
GGAGAGATCCTGCTGTCAATCTTGAAAAATGGACTAACAAAGGATCACTAATTGGTATCACAGGCAGAATTAATACTAGA
AATTATGAAAACCAACAAGGTCAGAAAGTCTATGTAACTGAGGTTATTGCTGACAATTTCCAGTTACTAGAAAGTCGCAA
GGATAATAACCAAGGGACACCTCAAAATAACCAAGGTTATCAACAGCCTCAGAATAATAACCAACAACCTCAAAATAATT
ATCAACAAAATAACCAAGGTTATCAACAAACAAACAATCAAGGGTTTAATCAAGGTCAGCAAGGAAGTTTCTTTGATGGC
ATGACTACAAATCCAATGGATATCAGTGATGACGATTTGCCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.618 |
100 |
0.566 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.056 |
100 |
0.56 |