Detailed information
Overview
| Name | comGF | Type | Machinery gene |
| Locus tag | ACGLYC_RS11970 | Genome accession | NZ_CP171691 |
| Coordinates | 2469897..2470064 (-) | Length | 55 a.a. |
| NCBI ID | WP_235183824.1 | Uniprot ID | - |
| Organism | Bacillus velezensis strain K12 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 2464897..2475064
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACGLYC_RS11925 (ACGLYC_11925) | - | 2465017..2465811 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| ACGLYC_RS11930 (ACGLYC_11930) | sinI | 2465988..2466161 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| ACGLYC_RS11935 (ACGLYC_11935) | sinR | 2466195..2466530 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ACGLYC_RS11940 (ACGLYC_11940) | tasA | 2466578..2467363 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| ACGLYC_RS11945 (ACGLYC_11945) | sipW | 2467428..2468012 (-) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| ACGLYC_RS11950 (ACGLYC_11950) | tapA | 2467984..2468655 (-) | 672 | WP_020954230.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ACGLYC_RS11955 (ACGLYC_11955) | - | 2468914..2469243 (+) | 330 | WP_020954231.1 | DUF3889 domain-containing protein | - |
| ACGLYC_RS11960 (ACGLYC_11960) | - | 2469283..2469462 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| ACGLYC_RS11965 (ACGLYC_11965) | comGG | 2469519..2469896 (-) | 378 | WP_032866434.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ACGLYC_RS11970 (ACGLYC_11970) | comGF | 2469897..2470064 (-) | 168 | WP_235183824.1 | ComGF family competence protein | Machinery gene |
| ACGLYC_RS11975 (ACGLYC_11975) | - | 2470061..2470255 (-) | 195 | WP_225917419.1 | hypothetical protein | - |
| ACGLYC_RS11980 (ACGLYC_11980) | comGE | 2470299..2470613 (-) | 315 | WP_007408323.1 | competence type IV pilus minor pilin ComGE | - |
| ACGLYC_RS11985 (ACGLYC_11985) | comGD | 2470597..2471034 (-) | 438 | WP_007408322.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| ACGLYC_RS11990 (ACGLYC_11990) | comGC | 2471024..2471332 (-) | 309 | WP_003153087.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| ACGLYC_RS11995 (ACGLYC_11995) | comGB | 2471337..2472374 (-) | 1038 | WP_032866436.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| ACGLYC_RS12000 (ACGLYC_12000) | comGA | 2472361..2473431 (-) | 1071 | WP_012117985.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| ACGLYC_RS12005 (ACGLYC_12005) | - | 2473623..2474573 (-) | 951 | WP_015417820.1 | magnesium transporter CorA family protein | - |
Sequence
Protein
Download Length: 55 a.a. Molecular weight: 5847.82 Da Isoelectric Point: 10.6868
>NTDB_id=1063379 ACGLYC_RS11970 WP_235183824.1 2469897..2470064(-) (comGF) [Bacillus velezensis strain K12]
MIRKRVNGKGHVPILQNAASLTADVKNGLLLLEISSVAGQKNQAVIPVYSSFKGD
MIRKRVNGKGHVPILQNAASLTADVKNGLLLLEISSVAGQKNQAVIPVYSSFKGD
Nucleotide
Download Length: 168 bp
>NTDB_id=1063379 ACGLYC_RS11970 WP_235183824.1 2469897..2470064(-) (comGF) [Bacillus velezensis strain K12]
ATGATAAGGAAAAGAGTAAACGGAAAAGGCCACGTGCCGATCCTGCAAAACGCGGCATCATTAACGGCTGATGTGAAAAA
CGGCCTGCTCTTATTAGAGATTTCAAGCGTTGCAGGTCAAAAGAATCAGGCGGTCATTCCGGTTTACAGCTCTTTTAAAG
GTGATTAA
ATGATAAGGAAAAGAGTAAACGGAAAAGGCCACGTGCCGATCCTGCAAAACGCGGCATCATTAACGGCTGATGTGAAAAA
CGGCCTGCTCTTATTAGAGATTTCAAGCGTTGCAGGTCAAAAGAATCAGGCGGTCATTCCGGTTTACAGCTCTTTTAAAG
GTGATTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGF | Bacillus subtilis subsp. subtilis str. 168 |
51.852 |
98.182 |
0.509 |