Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   ACF0HW_RS06750 Genome accession   NZ_CP171208
Coordinates   1302219..1302392 (-) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus amyloliquefaciens strain HN11     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1297219..1307392
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACF0HW_RS06700 comGD 1297339..1297776 (+) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACF0HW_RS06705 comGE 1297760..1298074 (+) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  ACF0HW_RS06710 comGF 1297983..1298483 (+) 501 WP_012117981.1 competence type IV pilus minor pilin ComGF -
  ACF0HW_RS06715 comGG 1298484..1298861 (+) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACF0HW_RS06720 - 1298918..1299097 (+) 180 WP_003153093.1 YqzE family protein -
  ACF0HW_RS06725 - 1299137..1299466 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  ACF0HW_RS06730 tapA 1299725..1300396 (+) 672 WP_012117978.1 amyloid fiber anchoring/assembly protein TapA -
  ACF0HW_RS06735 sipW 1300368..1300952 (+) 585 WP_012117977.1 signal peptidase I SipW -
  ACF0HW_RS06740 tasA 1301017..1301802 (+) 786 WP_007408329.1 biofilm matrix protein TasA -
  ACF0HW_RS06745 sinR 1301850..1302185 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACF0HW_RS06750 sinI 1302219..1302392 (-) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACF0HW_RS06755 - 1302569..1303363 (-) 795 WP_012117976.1 YqhG family protein -
  ACF0HW_RS06760 - 1303385..1305055 (-) 1671 WP_012117975.1 DEAD/DEAH box helicase -
  ACF0HW_RS06765 gcvT 1305479..1306579 (+) 1101 WP_012117974.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=1060479 ACF0HW_RS06750 WP_003153105.1 1302219..1302392(-) (sinI) [Bacillus amyloliquefaciens strain HN11]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1060479 ACF0HW_RS06750 WP_003153105.1 1302219..1302392(-) (sinI) [Bacillus amyloliquefaciens strain HN11]
ATGAAAAATGCAAAAATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702

Multiple sequence alignment