Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACF0HW_RS03735 Genome accession   NZ_CP171208
Coordinates   729461..729601 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain HN11     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 724461..734601
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACF0HW_RS03710 - 724765..725163 (+) 399 WP_003152031.1 YueI family protein -
  ACF0HW_RS03715 - 725260..725811 (+) 552 WP_003152033.1 cysteine hydrolase family protein -
  ACF0HW_RS03720 - 725829..727295 (+) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  ACF0HW_RS03725 - 727425..728648 (+) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  ACF0HW_RS03730 - 728655..728996 (-) 342 WP_012118316.1 hypothetical protein -
  ACF0HW_RS03735 degQ 729461..729601 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  ACF0HW_RS03740 - 729809..730669 (+) 861 WP_012118315.1 polyprenyl synthetase family protein -
  ACF0HW_RS03745 comX 730638..730811 (+) 174 WP_012118314.1 competence pheromone ComX -
  ACF0HW_RS03750 comP 730825..733125 (+) 2301 WP_012118313.1 histidine kinase Regulator
  ACF0HW_RS03755 comA 733206..733850 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  ACF0HW_RS03760 - 733872..734255 (+) 384 WP_012118312.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1060458 ACF0HW_RS03735 WP_003152043.1 729461..729601(+) (degQ) [Bacillus amyloliquefaciens strain HN11]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1060458 ACF0HW_RS03735 WP_003152043.1 729461..729601(+) (degQ) [Bacillus amyloliquefaciens strain HN11]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment