Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ACFXAC_RS11755 Genome accession   NZ_CP170720
Coordinates   2461523..2461696 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus amyloliquefaciens strain JP5006     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2456523..2466696
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACFXAC_RS11740 (ACFXAC_11740) gcvT 2457336..2458436 (-) 1101 WP_053573200.1 glycine cleavage system aminomethyltransferase GcvT -
  ACFXAC_RS11745 (ACFXAC_11745) - 2458860..2460530 (+) 1671 WP_031378948.1 DEAD/DEAH box helicase -
  ACFXAC_RS11750 (ACFXAC_11750) - 2460552..2461346 (+) 795 WP_007408330.1 YqhG family protein -
  ACFXAC_RS11755 (ACFXAC_11755) sinI 2461523..2461696 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACFXAC_RS11760 (ACFXAC_11760) sinR 2461730..2462065 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACFXAC_RS11765 (ACFXAC_11765) tasA 2462113..2462898 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  ACFXAC_RS11770 (ACFXAC_11770) sipW 2462963..2463547 (-) 585 WP_015240205.1 signal peptidase I SipW -
  ACFXAC_RS11775 (ACFXAC_11775) tapA 2463519..2464190 (-) 672 WP_053573199.1 amyloid fiber anchoring/assembly protein TapA -
  ACFXAC_RS11780 (ACFXAC_11780) - 2464449..2464778 (+) 330 WP_039254490.1 DUF3889 domain-containing protein -
  ACFXAC_RS11785 (ACFXAC_11785) - 2464818..2464997 (-) 180 WP_003153093.1 YqzE family protein -
  ACFXAC_RS11790 (ACFXAC_11790) comGG 2465054..2465431 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACFXAC_RS11795 (ACFXAC_11795) comGF 2465432..2465932 (-) 501 WP_256052909.1 competence type IV pilus minor pilin ComGF -
  ACFXAC_RS11800 (ACFXAC_11800) comGE 2465841..2466155 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  ACFXAC_RS11805 (ACFXAC_11805) comGD 2466139..2466576 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=1058815 ACFXAC_RS11755 WP_003153105.1 2461523..2461696(+) (sinI) [Bacillus amyloliquefaciens strain JP5006]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1058815 ACFXAC_RS11755 WP_003153105.1 2461523..2461696(+) (sinI) [Bacillus amyloliquefaciens strain JP5006]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702


Multiple sequence alignment