Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ACFXAC_RS11755 | Genome accession | NZ_CP170720 |
| Coordinates | 2461523..2461696 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus amyloliquefaciens strain JP5006 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2456523..2466696
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACFXAC_RS11740 (ACFXAC_11740) | gcvT | 2457336..2458436 (-) | 1101 | WP_053573200.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ACFXAC_RS11745 (ACFXAC_11745) | - | 2458860..2460530 (+) | 1671 | WP_031378948.1 | DEAD/DEAH box helicase | - |
| ACFXAC_RS11750 (ACFXAC_11750) | - | 2460552..2461346 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| ACFXAC_RS11755 (ACFXAC_11755) | sinI | 2461523..2461696 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| ACFXAC_RS11760 (ACFXAC_11760) | sinR | 2461730..2462065 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ACFXAC_RS11765 (ACFXAC_11765) | tasA | 2462113..2462898 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| ACFXAC_RS11770 (ACFXAC_11770) | sipW | 2462963..2463547 (-) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| ACFXAC_RS11775 (ACFXAC_11775) | tapA | 2463519..2464190 (-) | 672 | WP_053573199.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ACFXAC_RS11780 (ACFXAC_11780) | - | 2464449..2464778 (+) | 330 | WP_039254490.1 | DUF3889 domain-containing protein | - |
| ACFXAC_RS11785 (ACFXAC_11785) | - | 2464818..2464997 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| ACFXAC_RS11790 (ACFXAC_11790) | comGG | 2465054..2465431 (-) | 378 | WP_015417814.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ACFXAC_RS11795 (ACFXAC_11795) | comGF | 2465432..2465932 (-) | 501 | WP_256052909.1 | competence type IV pilus minor pilin ComGF | - |
| ACFXAC_RS11800 (ACFXAC_11800) | comGE | 2465841..2466155 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| ACFXAC_RS11805 (ACFXAC_11805) | comGD | 2466139..2466576 (-) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1058815 ACFXAC_RS11755 WP_003153105.1 2461523..2461696(+) (sinI) [Bacillus amyloliquefaciens strain JP5006]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1058815 ACFXAC_RS11755 WP_003153105.1 2461523..2461696(+) (sinI) [Bacillus amyloliquefaciens strain JP5006]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |