Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   ACFW98_RS15630 Genome accession   NZ_CP170719
Coordinates   3256506..3256625 (+) Length   39 a.a.
NCBI ID   WP_033575081.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain JP5008     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 3251506..3261625
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACFW98_RS15615 (ACFW98_15615) - 3253118..3253801 (+) 684 WP_007410267.1 response regulator transcription factor -
  ACFW98_RS15620 (ACFW98_15620) - 3253788..3255221 (+) 1434 WP_162992601.1 HAMP domain-containing sensor histidine kinase -
  ACFW98_RS15625 (ACFW98_15625) rapC 3255374..3256522 (+) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  ACFW98_RS15630 (ACFW98_15630) phrC 3256506..3256625 (+) 120 WP_033575081.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  ACFW98_RS15635 (ACFW98_15635) - 3256774..3256884 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  ACFW98_RS15640 (ACFW98_15640) - 3256964..3258328 (-) 1365 WP_059366589.1 aspartate kinase -
  ACFW98_RS15645 (ACFW98_15645) ceuB 3258742..3259695 (+) 954 WP_059366593.1 ABC transporter permease Machinery gene
  ACFW98_RS15650 (ACFW98_15650) - 3259685..3260632 (+) 948 WP_007410274.1 iron chelate uptake ABC transporter family permease subunit -
  ACFW98_RS15655 (ACFW98_15655) - 3260626..3261384 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4214.93 Da        Isoelectric Point: 8.0284

>NTDB_id=1058760 ACFW98_RS15630 WP_033575081.1 3256506..3256625(+) (phrC) [Bacillus amyloliquefaciens strain JP5008]
MKLKSKWFVICLAAAAIFTVTGAGQTDQADFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=1058760 ACFW98_RS15630 WP_033575081.1 3256506..3256625(+) (phrC) [Bacillus amyloliquefaciens strain JP5008]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGACTTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

72.5

100

0.744


Multiple sequence alignment