Detailed information NTG1058717

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: ACFW98_RS05795
• Genome accession: NZ_CP170719
• Coordinates: 1284523..1284960 (-)
• Length: 145 a.a.
• NCBI ID: WP_012117983.1
• Uniprot ID: -
• Organism: Bacillus amyloliquefaciens strain JP5008
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1279523..1289960

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACFW98_RS05745 (ACFW98_05745)	sinI	1279907..1280080 (+)	174	WP_003153105.1	anti-repressor SinI	Regulator
ACFW98_RS05750 (ACFW98_05750)	sinR	1280114..1280449 (+)	336	WP_003153104.1	transcriptional regulator SinR	Regulator
ACFW98_RS05755 (ACFW98_05755)	tasA	1280497..1281282 (-)	786	WP_007408329.1	biofilm matrix protein TasA	-
ACFW98_RS05760 (ACFW98_05760)	sipW	1281347..1281931 (-)	585	WP_015240205.1	signal peptidase I SipW	-
ACFW98_RS05765 (ACFW98_05765)	tapA	1281903..1282574 (-)	672	WP_113766732.1	amyloid fiber anchoring/assembly protein TapA	-
ACFW98_RS05770 (ACFW98_05770)	-	1282833..1283162 (+)	330	WP_095352945.1	DUF3889 domain-containing protein	-
ACFW98_RS05775 (ACFW98_05775)	-	1283202..1283381 (-)	180	WP_003153093.1	YqzE family protein	-
ACFW98_RS05780 (ACFW98_05780)	comGG	1283438..1283815 (-)	378	WP_015417814.1	competence type IV pilus minor pilin ComGG	Machinery gene
ACFW98_RS05785 (ACFW98_05785)	comGF	1283816..1284211 (-)	396	WP_064115389.1	competence type IV pilus minor pilin ComGF	-
ACFW98_RS05790 (ACFW98_05790)	comGE	1284225..1284539 (-)	315	WP_064115388.1	competence type IV pilus minor pilin ComGE	-
ACFW98_RS05795 (ACFW98_05795)	comGD	1284523..1284960 (-)	438	WP_012117983.1	competence type IV pilus minor pilin ComGD	Machinery gene
ACFW98_RS05800 (ACFW98_05800)	comGC	1284950..1285258 (-)	309	WP_015417818.1	competence type IV pilus major pilin ComGC	Machinery gene
ACFW98_RS05805 (ACFW98_05805)	comGB	1285263..1286300 (-)	1038	WP_053573197.1	competence type IV pilus assembly protein ComGB	Machinery gene
ACFW98_RS05810 (ACFW98_05810)	comGA	1286287..1287357 (-)	1071	WP_003153083.1	competence type IV pilus ATPase ComGA	Machinery gene
ACFW98_RS05815 (ACFW98_05815)	-	1287550..1288500 (-)	951	WP_015417820.1	magnesium transporter CorA family protein	-
ACFW98_RS05820 (ACFW98_05820)	-	1288646..1289947 (+)	1302	WP_012117986.1	hemolysin family protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16286.74 Da
• Isoelectric Point: 10.2475

>NTDB_id=1058717 ACFW98_RS05795 WP_012117983.1 1284523..1284960(-) (comGD) [Bacillus amyloliquefaciens strain JP5008]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide

• Length: 438 bp

>NTDB_id=1058717 ACFW98_RS05795 WP_012117983.1 1284523..1284960(-) (comGD) [Bacillus amyloliquefaciens strain JP5008]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGTCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCCTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATCCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	56.849	100	0.572