Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ACFW98_RS05745 | Genome accession | NZ_CP170719 |
| Coordinates | 1279907..1280080 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus amyloliquefaciens strain JP5008 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1274907..1285080
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACFW98_RS05730 (ACFW98_05730) | gcvT | 1275720..1276820 (-) | 1101 | WP_395097031.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ACFW98_RS05735 (ACFW98_05735) | - | 1277244..1278914 (+) | 1671 | WP_031378948.1 | DEAD/DEAH box helicase | - |
| ACFW98_RS05740 (ACFW98_05740) | - | 1278936..1279730 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| ACFW98_RS05745 (ACFW98_05745) | sinI | 1279907..1280080 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| ACFW98_RS05750 (ACFW98_05750) | sinR | 1280114..1280449 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ACFW98_RS05755 (ACFW98_05755) | tasA | 1280497..1281282 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| ACFW98_RS05760 (ACFW98_05760) | sipW | 1281347..1281931 (-) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| ACFW98_RS05765 (ACFW98_05765) | tapA | 1281903..1282574 (-) | 672 | WP_113766732.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ACFW98_RS05770 (ACFW98_05770) | - | 1282833..1283162 (+) | 330 | WP_095352945.1 | DUF3889 domain-containing protein | - |
| ACFW98_RS05775 (ACFW98_05775) | - | 1283202..1283381 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| ACFW98_RS05780 (ACFW98_05780) | comGG | 1283438..1283815 (-) | 378 | WP_015417814.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ACFW98_RS05785 (ACFW98_05785) | comGF | 1283816..1284211 (-) | 396 | WP_064115389.1 | competence type IV pilus minor pilin ComGF | - |
| ACFW98_RS05790 (ACFW98_05790) | comGE | 1284225..1284539 (-) | 315 | WP_064115388.1 | competence type IV pilus minor pilin ComGE | - |
| ACFW98_RS05795 (ACFW98_05795) | comGD | 1284523..1284960 (-) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1058714 ACFW98_RS05745 WP_003153105.1 1279907..1280080(+) (sinI) [Bacillus amyloliquefaciens strain JP5008]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1058714 ACFW98_RS05745 WP_003153105.1 1279907..1280080(+) (sinI) [Bacillus amyloliquefaciens strain JP5008]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |