Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ACFXAD_RS08775 | Genome accession | NZ_CP170653 |
| Coordinates | 1700872..1701045 (-) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus amyloliquefaciens strain JP5011 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1695872..1706045
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACFXAD_RS08725 (ACFXAD_08725) | comGD | 1695992..1696429 (+) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| ACFXAD_RS08730 (ACFXAD_08730) | comGE | 1696413..1696727 (+) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| ACFXAD_RS08735 (ACFXAD_08735) | comGF | 1696636..1697136 (+) | 501 | WP_256052909.1 | competence type IV pilus minor pilin ComGF | - |
| ACFXAD_RS08740 (ACFXAD_08740) | comGG | 1697137..1697514 (+) | 378 | WP_015417814.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ACFXAD_RS08745 (ACFXAD_08745) | - | 1697571..1697750 (+) | 180 | WP_003153093.1 | YqzE family protein | - |
| ACFXAD_RS08750 (ACFXAD_08750) | - | 1697790..1698119 (-) | 330 | WP_039254490.1 | DUF3889 domain-containing protein | - |
| ACFXAD_RS08755 (ACFXAD_08755) | tapA | 1698378..1699049 (+) | 672 | WP_053573199.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ACFXAD_RS08760 (ACFXAD_08760) | sipW | 1699021..1699605 (+) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| ACFXAD_RS08765 (ACFXAD_08765) | tasA | 1699670..1700455 (+) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| ACFXAD_RS08770 (ACFXAD_08770) | sinR | 1700503..1700838 (-) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ACFXAD_RS08775 (ACFXAD_08775) | sinI | 1700872..1701045 (-) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| ACFXAD_RS08780 (ACFXAD_08780) | - | 1701222..1702016 (-) | 795 | WP_007408330.1 | YqhG family protein | - |
| ACFXAD_RS08785 (ACFXAD_08785) | - | 1702038..1703708 (-) | 1671 | WP_031378948.1 | DEAD/DEAH box helicase | - |
| ACFXAD_RS08790 (ACFXAD_08790) | gcvT | 1704132..1705232 (+) | 1101 | WP_053573200.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1058495 ACFXAD_RS08775 WP_003153105.1 1700872..1701045(-) (sinI) [Bacillus amyloliquefaciens strain JP5011]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1058495 ACFXAD_RS08775 WP_003153105.1 1700872..1701045(-) (sinI) [Bacillus amyloliquefaciens strain JP5011]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |