Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   ACFW99_RS01870 Genome accession   NZ_CP170651
Coordinates   402535..402654 (+) Length   39 a.a.
NCBI ID   WP_031378677.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain JP5025     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 397535..407654
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACFW99_RS01855 (ACFW99_01855) - 399147..399830 (+) 684 WP_007410267.1 response regulator transcription factor -
  ACFW99_RS01860 (ACFW99_01860) - 399817..401250 (+) 1434 WP_015416810.1 HAMP domain-containing sensor histidine kinase -
  ACFW99_RS01865 (ACFW99_01865) rapC 401403..402551 (+) 1149 WP_033575082.1 Rap family tetratricopeptide repeat protein Regulator
  ACFW99_RS01870 (ACFW99_01870) phrC 402535..402654 (+) 120 WP_031378677.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  ACFW99_RS01875 (ACFW99_01875) - 402803..402913 (-) 111 WP_369719092.1 YjcZ family sporulation protein -
  ACFW99_RS01880 (ACFW99_01880) - 402993..404357 (-) 1365 WP_015416811.1 aspartate kinase -
  ACFW99_RS01885 (ACFW99_01885) ceuB 404771..405724 (+) 954 WP_015239156.1 ABC transporter permease Machinery gene
  ACFW99_RS01890 (ACFW99_01890) - 405714..406661 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  ACFW99_RS01895 (ACFW99_01895) - 406655..407413 (+) 759 WP_015416812.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4240.97 Da        Isoelectric Point: 8.0284

>NTDB_id=1058385 ACFW99_RS01870 WP_031378677.1 402535..402654(+) (phrC) [Bacillus amyloliquefaciens strain JP5025]
MKLKSKWFVICLAAAAIFTVTGAGQPDQADFHVTERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=1058385 ACFW99_RS01870 WP_031378677.1 402535..402654(+) (phrC) [Bacillus amyloliquefaciens strain JP5025]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGCCAGA
TCAGGCTGACTTCCATGTAACTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

75

100

0.769


Multiple sequence alignment