Detailed information
Bioinformatically predicted
Overview
| Name | degQ | Type | Regulator |
| Locus tag | ACFXAB_RS07840 | Genome accession | NZ_CP170650 |
| Coordinates | 1563919..1564059 (+) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain JP5039 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1558919..1569059
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACFXAB_RS07815 (ACFXAB_07815) | - | 1559222..1559620 (+) | 399 | WP_003152031.1 | YueI family protein | - |
| ACFXAB_RS07820 (ACFXAB_07820) | - | 1559717..1560268 (+) | 552 | WP_003152033.1 | cysteine hydrolase family protein | - |
| ACFXAB_RS07825 (ACFXAB_07825) | - | 1560286..1561752 (+) | 1467 | WP_014418767.1 | nicotinate phosphoribosyltransferase | - |
| ACFXAB_RS07830 (ACFXAB_07830) | - | 1561882..1563105 (+) | 1224 | WP_014418766.1 | EAL and HDOD domain-containing protein | - |
| ACFXAB_RS07835 (ACFXAB_07835) | - | 1563112..1563453 (-) | 342 | WP_014418765.1 | hypothetical protein | - |
| ACFXAB_RS07840 (ACFXAB_07840) | degQ | 1563919..1564059 (+) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| ACFXAB_RS07845 (ACFXAB_07845) | - | 1564211..1565116 (+) | 906 | WP_014418764.1 | polyprenyl synthetase family protein | - |
| ACFXAB_RS07850 (ACFXAB_07850) | comX | 1565116..1565286 (+) | 171 | WP_032863917.1 | competence pheromone ComX | - |
| ACFXAB_RS07855 (ACFXAB_07855) | comP | 1565264..1567615 (+) | 2352 | WP_269800792.1 | sensor histidine kinase | Regulator |
| ACFXAB_RS07860 (ACFXAB_07860) | comA | 1567696..1568340 (+) | 645 | WP_014418762.1 | response regulator transcription factor | Regulator |
| ACFXAB_RS07865 (ACFXAB_07865) | - | 1568362..1568745 (+) | 384 | WP_014418761.1 | hotdog fold thioesterase | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=1058328 ACFXAB_RS07840 WP_003152043.1 1563919..1564059(+) (degQ) [Bacillus velezensis strain JP5039]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=1058328 ACFXAB_RS07840 WP_003152043.1 1563919..1564059(+) (degQ) [Bacillus velezensis strain JP5039]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |