Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   ACFION_RS08395 Genome accession   NZ_CP170399
Coordinates   1647816..1648259 (-) Length   147 a.a.
NCBI ID   WP_001099009.1    Uniprot ID   A0A0C6EXF8
Organism   Staphylococcus aureus strain t127     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1612053..1655681 1647816..1648259 within 0


Gene organization within MGE regions


Location: 1612053..1655681
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACFION_RS08130 - 1612053..1612736 (-) 684 WP_000180531.1 restriction endonuclease -
  ACFION_RS08135 - 1612733..1612915 (-) 183 WP_000990948.1 hypothetical protein -
  ACFION_RS08140 - 1613013..1614062 (-) 1050 WP_000405105.1 hypothetical protein -
  ACFION_RS08145 - 1614461..1615915 (-) 1455 WP_000909217.1 N-acetylmuramoyl-L-alanine amidase -
  ACFION_RS08150 - 1615926..1616228 (-) 303 WP_000339141.1 phage holin -
  ACFION_RS08155 - 1616284..1616679 (-) 396 WP_000398878.1 hypothetical protein -
  ACFION_RS08160 - 1616684..1617922 (-) 1239 WP_038412581.1 BppU family phage baseplate upper protein -
  ACFION_RS08165 - 1617935..1619809 (-) 1875 WP_000524040.1 glucosaminidase domain-containing protein -
  ACFION_RS08170 - 1619946..1620245 (-) 300 WP_000466769.1 DUF2951 domain-containing protein -
  ACFION_RS08175 - 1620286..1620459 (-) 174 WP_001790193.1 XkdX family protein -
  ACFION_RS08180 - 1620463..1620840 (-) 378 WP_000705921.1 DUF2977 domain-containing protein -
  ACFION_RS08185 - 1620840..1622663 (-) 1824 WP_029052110.1 phage baseplate upper protein -
  ACFION_RS08190 - 1622663..1624561 (-) 1899 WP_054189010.1 hypothetical protein -
  ACFION_RS08195 - 1624574..1626460 (-) 1887 WP_168752845.1 SGNH/GDSL hydrolase family protein -
  ACFION_RS08200 - 1626471..1627412 (-) 942 WP_000560181.1 phage tail domain-containing protein -
  ACFION_RS08205 - 1627427..1630312 (-) 2886 WP_077517555.1 terminase -
  ACFION_RS08210 - 1630316..1630600 (-) 285 WP_000880587.1 hypothetical protein -
  ACFION_RS08215 - 1630645..1631151 (-) 507 WP_000134337.1 tail assembly chaperone -
  ACFION_RS08220 - 1631218..1631775 (-) 558 WP_000057582.1 tail protein -
  ACFION_RS08225 - 1631776..1632201 (-) 426 WP_000270192.1 DUF3168 domain-containing protein -
  ACFION_RS08230 - 1632214..1632627 (-) 414 WP_168752846.1 HK97-gp10 family putative phage morphogenesis protein -
  ACFION_RS08235 - 1632614..1632949 (-) 336 WP_000483040.1 phage head closure protein -
  ACFION_RS08240 - 1632961..1633311 (-) 351 WP_000177352.1 hypothetical protein -
  ACFION_RS08245 - 1633317..1633460 (-) 144 WP_000002931.1 hypothetical protein -
  ACFION_RS08250 - 1633472..1634386 (-) 915 WP_000235168.1 phage major capsid protein -
  ACFION_RS08255 - 1634403..1634987 (-) 585 WP_001019221.1 DUF4355 domain-containing protein -
  ACFION_RS08260 - 1635090..1635296 (-) 207 WP_000346032.1 hypothetical protein -
  ACFION_RS08265 - 1635298..1636251 (-) 954 WP_410531209.1 phage head morphogenesis protein -
  ACFION_RS08270 - 1636220..1637644 (-) 1425 WP_000177426.1 phage portal protein -
  ACFION_RS08275 - 1637641..1638864 (-) 1224 WP_001037578.1 PBSX family phage terminase large subunit -
  ACFION_RS08280 - 1638857..1639318 (-) 462 WP_001794914.1 hypothetical protein -
  ACFION_RS08285 - 1639682..1640104 (-) 423 WP_000162701.1 RinA family phage transcriptional activator -
  ACFION_RS08290 - 1640128..1640274 (-) 147 WP_000990005.1 hypothetical protein -
  ACFION_RS08295 rinB 1640275..1640448 (-) 174 WP_000595258.1 transcriptional activator RinB -
  ACFION_RS08300 - 1640495..1641019 (-) 525 WP_015984519.1 hypothetical protein -
  ACFION_RS08305 - 1641019..1641213 (-) 195 WP_015984518.1 DUF1381 domain-containing protein -
  ACFION_RS08310 - 1641250..1641786 (-) 537 WP_015984517.1 dUTPase -
  ACFION_RS08315 - 1641779..1641949 (-) 171 WP_000714413.1 hypothetical protein -
  ACFION_RS08320 - 1641936..1642190 (-) 255 WP_017804684.1 DUF1024 family protein -
  ACFION_RS08325 - 1642183..1642548 (-) 366 WP_001624703.1 hypothetical protein -
  ACFION_RS08330 - 1642545..1642994 (-) 450 WP_000982708.1 YopX family protein -
  ACFION_RS08335 - 1643059..1643301 (-) 243 WP_015984514.1 SAV1978 family virulence-associated passenger protein -
  ACFION_RS08340 - 1643305..1643661 (-) 357 WP_000029376.1 SA1788 family PVL leukocidin-associated protein -
  ACFION_RS08345 - 1643789..1644094 (-) 306 WP_000101252.1 hypothetical protein -
  ACFION_RS08350 - 1644095..1644280 (-) 186 WP_001187243.1 DUF3113 family protein -
  ACFION_RS08355 - 1644285..1644689 (-) 405 WP_000049794.1 DUF1064 domain-containing protein -
  ACFION_RS08360 - 1644699..1644920 (-) 222 WP_015984512.1 DUF3269 family protein -
  ACFION_RS08365 - 1644933..1645091 (-) 159 WP_000256589.1 hypothetical protein -
  ACFION_RS08370 - 1645085..1645864 (-) 780 WP_000803062.1 ATP-binding protein -
  ACFION_RS08375 - 1645874..1646644 (-) 771 WP_000190253.1 conserved phage C-terminal domain-containing protein -
  ACFION_RS08380 - 1646710..1646991 (+) 282 WP_000414755.1 hypothetical protein -
  ACFION_RS08385 - 1646984..1647133 (-) 150 WP_001081076.1 hypothetical protein -
  ACFION_RS08390 - 1647130..1647804 (-) 675 WP_000057263.1 putative HNHc nuclease -
  ACFION_RS08395 ssbA 1647816..1648259 (-) 444 WP_001099009.1 single-stranded DNA-binding protein Machinery gene
  ACFION_RS08400 - 1648256..1648906 (-) 651 WP_000840496.1 ERF family protein -
  ACFION_RS08405 - 1648907..1649443 (-) 537 WP_001004336.1 host-nuclease inhibitor Gam family protein -
  ACFION_RS08410 - 1649456..1649716 (-) 261 WP_000291067.1 DUF1108 family protein -
  ACFION_RS08415 - 1649780..1650094 (-) 315 WP_031838381.1 hypothetical protein -
  ACFION_RS08420 - 1650099..1650269 (-) 171 WP_033842703.1 DUF1270 domain-containing protein -
  ACFION_RS08425 - 1650373..1651080 (-) 708 WP_168752764.1 ORF6C domain-containing protein -
  ACFION_RS08430 - 1651140..1651622 (+) 483 WP_168752765.1 hypothetical protein -
  ACFION_RS08435 - 1651856..1652110 (-) 255 WP_168752766.1 helix-turn-helix domain-containing protein -
  ACFION_RS08440 - 1652301..1652939 (+) 639 WP_168752767.1 XRE family transcriptional regulator -
  ACFION_RS08445 - 1652991..1653974 (+) 984 WP_168752768.1 glycosyltransferase family 2 protein -
  ACFION_RS08450 - 1653985..1654227 (+) 243 WP_168752769.1 hypothetical protein -
  ACFION_RS08455 - 1654290..1655681 (+) 1392 WP_410531215.1 recombinase family protein -

Sequence


Protein


Download         Length: 147 a.a.        Molecular weight: 16321.89 Da        Isoelectric Point: 5.8347

>NTDB_id=1056737 ACFION_RS08395 WP_001099009.1 1647816..1648259(-) (ssbA) [Staphylococcus aureus strain t127]
MNTVNLIGNLVADPELKGQNNNVVNFVIAVQRPFKNKQTNEYETDFIRCVAFGKTAEIIANNFNKGNKIGVTGSIQTGSY
ENNQGQKVFTTDIAVNNITFVERKNNGQSNNQQQHNSYNAPQNRQQSNNPFANANGPIEISDDDLPF

Nucleotide


Download         Length: 444 bp        

>NTDB_id=1056737 ACFION_RS08395 WP_001099009.1 1647816..1648259(-) (ssbA) [Staphylococcus aureus strain t127]
ATGAATACAGTAAATTTAATTGGGAACCTAGTGGCAGATCCAGAGTTAAAAGGTCAAAACAACAACGTAGTTAACTTTGT
AATCGCAGTACAGAGACCATTCAAAAACAAACAAACTAACGAATATGAAACAGACTTCATTCGTTGTGTTGCATTTGGTA
AGACTGCTGAAATCATCGCTAATAACTTTAATAAAGGTAATAAAATTGGCGTTACTGGTTCAATACAAACCGGTAGTTAT
GAAAATAATCAAGGACAGAAAGTGTTTACTACAGACATCGCAGTCAACAATATAACTTTCGTTGAACGTAAAAACAACGG
TCAATCTAACAACCAACAACAGCATAATTCATATAACGCACCACAGAATAGACAGCAATCAAATAATCCATTTGCTAATG
CTAATGGTCCTATAGAAATCTCTGACGATGATTTACCTTTCTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0C6EXF8

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

41.279

100

0.483

  ssb Latilactobacillus sakei subsp. sakei 23K

38.235

100

0.442


Multiple sequence alignment