Detailed information NTG1056510

Bioinformatically predicted

Overview

• Name: comE1/comEA
• Type: Machinery gene
• Locus tag: O1Q79_RS00995
• Genome accession: NZ_CP170386
• Coordinates: 193945..194298 (+)
• Length: 117 a.a.
• NCBI ID: WP_386692529.1
• Uniprot ID: -
• Organism: Lonepinella sp. MS14434
• Function: dsDNA binding (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Prophage	184373..196442	193945..194298	within	0

Gene organization within MGE regions

Location: 184373..196442

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
O1Q79_RS00930 (O1Q79_00186)	-	184373..185569 (+)	1197	WP_386692516.1	tyrosine-type recombinase/integrase	-
O1Q79_RS00935 (O1Q79_00187)	-	185995..186273 (+)	279	WP_386692517.1	helix-turn-helix transcriptional regulator	-
O1Q79_RS00940 (O1Q79_00188)	-	186270..186986 (+)	717	WP_386692518.1	hypothetical protein	-
O1Q79_RS00945 (O1Q79_00189)	-	187000..187686 (+)	687	WP_386692519.1	P2 family phage major capsid protein	-
O1Q79_RS00950 (O1Q79_00190)	-	187683..187931 (+)	249	WP_386692520.1	P2 family phage major capsid protein	-
O1Q79_RS00955 (O1Q79_00191)	-	188083..188946 (+)	864	WP_386692521.1	hypothetical protein	-
O1Q79_RS00960 (O1Q79_00192)	-	189091..189300 (+)	210	WP_386692522.1	helix-turn-helix transcriptional regulator	-
O1Q79_RS00965 (O1Q79_00193)	-	189300..189545 (+)	246	WP_386692523.1	hypothetical protein	-
O1Q79_RS00970 (O1Q79_00194)	-	189626..190222 (+)	597	WP_386692524.1	ash family protein	-
O1Q79_RS00975 (O1Q79_00195)	-	190215..190436 (+)	222	WP_386692525.1	hypothetical protein	-
O1Q79_RS00980 (O1Q79_00196)	-	190426..190770 (+)	345	WP_386692526.1	hypothetical protein	-
O1Q79_RS00985 (O1Q79_00197)	-	190770..190979 (+)	210	WP_386692527.1	hypothetical protein	-
O1Q79_RS00990 (O1Q79_00198)	-	191259..193163 (+)	1905	WP_386692528.1	DUF5906 domain-containing protein	-
O1Q79_RS00995 (O1Q79_00199)	comE1/comEA	193945..194298 (+)	354	WP_386692529.1	ComEA family DNA-binding protein	Machinery gene
O1Q79_RS01000 (O1Q79_00200)	-	194393..194665 (+)	273	WP_386692530.1	type II toxin-antitoxin system RelB/DinJ family antitoxin	-
O1Q79_RS01005 (O1Q79_00201)	purN	194710..195348 (-)	639	WP_386692531.1	phosphoribosylglycinamide formyltransferase	-
O1Q79_RS01010 (O1Q79_00202)	purM	195405..196442 (-)	1038	WP_386692532.1	phosphoribosylformylglycinamidine cyclo-ligase	-

Sequence

Protein

• Length: 117 a.a.
• Molecular weight: 12174.88 Da
• Isoelectric Point: 7.0098

>NTDB_id=1056510 O1Q79_RS00995 WP_386692529.1 193945..194298(+) (comE1/comEA) [Lonepinella sp. MS14434]
MKSIKALFGTVVLAGSLLGSANVFAETAQPATTAVQQVTAQTVATETQATVVGDKLNINTASAAEIQKALTGIGAKKAEA
IVQYRETHGAFTSLDQLLDVQGIGQATLDKNKDRIIF

Nucleotide

• Length: 354 bp

>NTDB_id=1056510 O1Q79_RS00995 WP_386692529.1 193945..194298(+) (comE1/comEA) [Lonepinella sp. MS14434]
ATGAAATCCATTAAAGCATTATTCGGCACAGTGGTACTAGCTGGCTCATTATTAGGCAGTGCAAACGTATTCGCAGAAAC
CGCACAACCAGCCACAACAGCCGTTCAGCAAGTTACTGCACAAACGGTTGCAACTGAAACACAAGCTACTGTAGTTGGTG
ATAAATTAAATATTAACACCGCTTCCGCCGCAGAAATTCAAAAAGCCTTAACGGGGATCGGAGCTAAAAAAGCTGAAGCC
ATTGTGCAATATCGTGAAACGCATGGTGCTTTCACTTCGTTAGATCAGTTATTAGACGTACAAGGTATTGGTCAAGCTAC
TTTAGATAAAAATAAAGATCGGATTATTTTCTAG

Domains

Predicted by InterproScan.

• Helix-hairpin-helix motif (HHH_3) (54-115)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comE1/comEA	Haemophilus influenzae Rd KW20	62.281	97.436	0.607
comEA/comE1	Glaesserella parasuis strain SC1401	52.525	84.615	0.444