Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   ACFBUK_RS11715 Genome accession   NZ_CP170331
Coordinates   2439654..2440031 (-) Length   125 a.a.
NCBI ID   WP_032874019.1    Uniprot ID   -
Organism   Bacillus velezensis strain GDMCC 820630     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2434654..2445031
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACFBUK_RS11675 (ACFBUK_11675) - 2435151..2435945 (+) 795 WP_007612541.1 YqhG family protein -
  ACFBUK_RS11680 (ACFBUK_11680) sinI 2436122..2436295 (+) 174 WP_032874029.1 anti-repressor SinI Regulator
  ACFBUK_RS11685 (ACFBUK_11685) sinR 2436329..2436664 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACFBUK_RS11690 (ACFBUK_11690) tasA 2436712..2437497 (-) 786 WP_032874027.1 biofilm matrix protein TasA -
  ACFBUK_RS11695 (ACFBUK_11695) sipW 2437562..2438146 (-) 585 WP_032874025.1 signal peptidase I SipW -
  ACFBUK_RS11700 (ACFBUK_11700) tapA 2438118..2438789 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  ACFBUK_RS11705 (ACFBUK_11705) - 2439048..2439377 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  ACFBUK_RS11710 (ACFBUK_11710) - 2439418..2439597 (-) 180 WP_022552966.1 YqzE family protein -
  ACFBUK_RS11715 (ACFBUK_11715) comGG 2439654..2440031 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACFBUK_RS11720 (ACFBUK_11720) comGF 2440032..2440532 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  ACFBUK_RS11725 (ACFBUK_11725) comGE 2440441..2440755 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACFBUK_RS11730 (ACFBUK_11730) comGD 2440739..2441176 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACFBUK_RS11735 (ACFBUK_11735) comGC 2441166..2441432 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  ACFBUK_RS11740 (ACFBUK_11740) comGB 2441479..2442516 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACFBUK_RS11745 (ACFBUK_11745) comGA 2442503..2443573 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  ACFBUK_RS11750 (ACFBUK_11750) - 2443770..2444720 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14077.01 Da        Isoelectric Point: 10.2236

>NTDB_id=1056147 ACFBUK_RS11715 WP_032874019.1 2439654..2440031(-) (comGG) [Bacillus velezensis strain GDMCC 820630]
MSKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMAQGKKARTGTQRFPYGTVS
FHISGSDRRETVQVTIQTETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=1056147 ACFBUK_RS11715 WP_032874019.1 2439654..2440031(-) (comGG) [Bacillus velezensis strain GDMCC 820630]
ATGTCCAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCAGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGGCACAGGGAAAAAAGGCCCGAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCTCCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGACGGAAACCACGACAGGTACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

49.194

99.2

0.488

Multiple sequence alignment