Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ACFBUK_RS11680 Genome accession   NZ_CP170331
Coordinates   2436122..2436295 (+) Length   57 a.a.
NCBI ID   WP_032874029.1    Uniprot ID   -
Organism   Bacillus velezensis strain GDMCC 820630     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2431122..2441295
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACFBUK_RS11665 (ACFBUK_11665) gcvT 2431936..2433036 (-) 1101 WP_032874033.1 glycine cleavage system aminomethyltransferase GcvT -
  ACFBUK_RS11670 (ACFBUK_11670) - 2433459..2435129 (+) 1671 WP_032874031.1 DEAD/DEAH box helicase -
  ACFBUK_RS11675 (ACFBUK_11675) - 2435151..2435945 (+) 795 WP_007612541.1 YqhG family protein -
  ACFBUK_RS11680 (ACFBUK_11680) sinI 2436122..2436295 (+) 174 WP_032874029.1 anti-repressor SinI Regulator
  ACFBUK_RS11685 (ACFBUK_11685) sinR 2436329..2436664 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACFBUK_RS11690 (ACFBUK_11690) tasA 2436712..2437497 (-) 786 WP_032874027.1 biofilm matrix protein TasA -
  ACFBUK_RS11695 (ACFBUK_11695) sipW 2437562..2438146 (-) 585 WP_032874025.1 signal peptidase I SipW -
  ACFBUK_RS11700 (ACFBUK_11700) tapA 2438118..2438789 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  ACFBUK_RS11705 (ACFBUK_11705) - 2439048..2439377 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  ACFBUK_RS11710 (ACFBUK_11710) - 2439418..2439597 (-) 180 WP_022552966.1 YqzE family protein -
  ACFBUK_RS11715 (ACFBUK_11715) comGG 2439654..2440031 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACFBUK_RS11720 (ACFBUK_11720) comGF 2440032..2440532 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  ACFBUK_RS11725 (ACFBUK_11725) comGE 2440441..2440755 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACFBUK_RS11730 (ACFBUK_11730) comGD 2440739..2441176 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6658.66 Da        Isoelectric Point: 9.8168

>NTDB_id=1056145 ACFBUK_RS11680 WP_032874029.1 2436122..2436295(+) (sinI) [Bacillus velezensis strain GDMCC 820630]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1056145 ACFBUK_RS11680 WP_032874029.1 2436122..2436295(+) (sinI) [Bacillus velezensis strain GDMCC 820630]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719


Multiple sequence alignment