Detailed information    

insolico Bioinformatically predicted

Overview


Name   vraR   Type   Regulator
Locus tag   ACFDHS_RS05355 Genome accession   NZ_CP170235
Coordinates   1103374..1104003 (+) Length   209 a.a.
NCBI ID   WP_039644795.1    Uniprot ID   A0A0A8HRY9
Organism   Staphylococcus hyicus strain SC362     
Function   repress expression of competence genes (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1084029..1136230 1103374..1104003 within 0


Gene organization within MGE regions


Location: 1084029..1136230
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACFDHS_RS05265 (ACFDHS_05265) putP 1084583..1086127 (-) 1545 WP_039644773.1 sodium/proline symporter PutP -
  ACFDHS_RS05270 (ACFDHS_05270) gatC 1086539..1086841 (+) 303 WP_037566951.1 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC -
  ACFDHS_RS05275 (ACFDHS_05275) gatA 1086844..1088304 (+) 1461 WP_107633467.1 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA -
  ACFDHS_RS05280 (ACFDHS_05280) gatB 1088318..1089745 (+) 1428 WP_039644777.1 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB -
  ACFDHS_RS05285 (ACFDHS_05285) - 1089986..1090918 (+) 933 WP_107633465.1 diacylglycerol kinase -
  ACFDHS_RS05290 (ACFDHS_05290) rlmD 1091019..1092389 (+) 1371 WP_039644779.1 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD -
  ACFDHS_RS05295 (ACFDHS_05295) - 1092401..1093714 (+) 1314 WP_305850350.1 carboxylesterase family protein -
  ACFDHS_RS05300 (ACFDHS_05300) - 1093812..1094351 (+) 540 WP_039644780.1 metalloprotease family protein -
  ACFDHS_RS05305 (ACFDHS_05305) dinB 1094540..1095610 (+) 1071 WP_039644781.1 DNA polymerase IV -
  ACFDHS_RS05310 (ACFDHS_05310) - 1095605..1096165 (-) 561 WP_305850349.1 3'-5' exonuclease -
  ACFDHS_RS05315 (ACFDHS_05315) - 1096263..1096766 (-) 504 WP_039644783.1 ferritin -
  ACFDHS_RS05320 (ACFDHS_05320) - 1096914..1098224 (+) 1311 WP_305850348.1 Mur ligase family protein -
  ACFDHS_RS05325 (ACFDHS_05325) - 1098225..1098956 (+) 732 WP_305850347.1 type 1 glutamine amidotransferase -
  ACFDHS_RS05330 (ACFDHS_05330) - 1099068..1100093 (-) 1026 WP_039644788.1 aromatic acid exporter family protein -
  ACFDHS_RS05335 (ACFDHS_05335) map 1100387..1101145 (+) 759 WP_107633460.1 type I methionyl aminopeptidase -
  ACFDHS_RS05340 (ACFDHS_05340) - 1101244..1101630 (+) 387 WP_052257806.1 hypothetical protein -
  ACFDHS_RS05345 (ACFDHS_05345) liaF 1101643..1102344 (+) 702 WP_107633459.1 cell wall-active antibiotics response protein LiaF -
  ACFDHS_RS05350 (ACFDHS_05350) vraS 1102341..1103384 (+) 1044 WP_380572727.1 sensor histidine kinase Regulator
  ACFDHS_RS05355 (ACFDHS_05355) vraR 1103374..1104003 (+) 630 WP_039644795.1 response regulator transcription factor Regulator
  ACFDHS_RS05360 (ACFDHS_05360) - 1104067..1104636 (-) 570 WP_039644796.1 carbonic anhydrase -
  ACFDHS_RS05365 (ACFDHS_05365) - 1104671..1105942 (-) 1272 WP_107633458.1 YihY/virulence factor BrkB family protein -
  ACFDHS_RS05370 (ACFDHS_05370) - 1106062..1106337 (-) 276 WP_039644801.1 hypothetical protein -
  ACFDHS_RS05375 (ACFDHS_05375) - 1106344..1106802 (-) 459 WP_039644802.1 low molecular weight protein-tyrosine-phosphatase -
  ACFDHS_RS05380 (ACFDHS_05380) - 1106935..1107144 (+) 210 WP_039644804.1 DUF1128 family protein -
  ACFDHS_RS05385 (ACFDHS_05385) - 1107161..1108396 (+) 1236 WP_039644805.1 aminopeptidase -
  ACFDHS_RS05390 (ACFDHS_05390) - 1108410..1108928 (+) 519 WP_039644807.1 acyl-CoA thioesterase -
  ACFDHS_RS05395 (ACFDHS_05395) yfkAB 1109056..1110189 (-) 1134 WP_039644810.1 radical SAM/CxCxxxxC motif protein YfkAB -
  ACFDHS_RS05400 (ACFDHS_05400) - 1110301..1110462 (+) 162 WP_167694559.1 SE1561 family protein -
  ACFDHS_RS05405 (ACFDHS_05405) - 1110530..1111048 (+) 519 WP_039644812.1 type 1 glutamine amidotransferase domain-containing protein -
  ACFDHS_RS05410 (ACFDHS_05410) - 1111246..1111680 (-) 435 Protein_1027 transposase -
  ACFDHS_RS05415 (ACFDHS_05415) - 1111804..1112088 (+) 285 WP_031867686.1 hypothetical protein -
  ACFDHS_RS05420 (ACFDHS_05420) - 1112257..1112577 (+) 321 WP_031863810.1 DUF961 family protein -
  ACFDHS_RS05425 (ACFDHS_05425) - 1112593..1112898 (+) 306 WP_031863809.1 hypothetical protein -
  ACFDHS_RS05430 (ACFDHS_05430) - 1113063..1114145 (+) 1083 WP_031912235.1 replication initiation factor domain-containing protein -
  ACFDHS_RS05435 (ACFDHS_05435) - 1114229..1115281 (+) 1053 WP_031867685.1 conjugal transfer protein -
  ACFDHS_RS05440 (ACFDHS_05440) - 1115285..1115545 (+) 261 WP_031863806.1 TcpD family membrane protein -
  ACFDHS_RS05445 (ACFDHS_05445) - 1115557..1115940 (+) 384 WP_031912234.1 TcpE family conjugal transfer membrane protein -
  ACFDHS_RS05450 (ACFDHS_05450) - 1115975..1118470 (+) 2496 WP_031867684.1 ATP-binding protein -
  ACFDHS_RS05455 (ACFDHS_05455) - 1118482..1119876 (+) 1395 WP_380572729.1 FtsK/SpoIIIE domain-containing protein -
  ACFDHS_RS05460 (ACFDHS_05460) - 1119892..1121751 (+) 1860 WP_031912232.1 CD3337/EF1877 family mobilome membrane protein -
  ACFDHS_RS05465 (ACFDHS_05465) - 1121741..1122778 (+) 1038 WP_031912231.1 CHAP domain-containing protein -
  ACFDHS_RS05470 (ACFDHS_05470) - 1122783..1123370 (+) 588 WP_031912230.1 hypothetical protein -
  ACFDHS_RS05475 (ACFDHS_05475) - 1123420..1123773 (+) 354 WP_031912229.1 cystatin-like fold lipoprotein -
  ACFDHS_RS05480 (ACFDHS_05480) - 1123884..1124387 (+) 504 WP_031912228.1 helix-turn-helix domain-containing protein -
  ACFDHS_RS05485 (ACFDHS_05485) - 1124425..1124904 (+) 480 WP_230373782.1 IS30 family transposase -
  ACFDHS_RS05490 (ACFDHS_05490) - 1124984..1125820 (-) 837 WP_380572732.1 transposase -
  ACFDHS_RS05495 (ACFDHS_05495) - 1126154..1127899 (-) 1746 WP_305850506.1 pyruvate oxidase -
  ACFDHS_RS05500 (ACFDHS_05500) sgtB 1128067..1128873 (+) 807 WP_039644816.1 monofunctional peptidoglycan glycosyltransferase SgtB -
  ACFDHS_RS05505 (ACFDHS_05505) recX 1128962..1129768 (+) 807 WP_305850507.1 recombination regulator RecX -
  ACFDHS_RS05510 (ACFDHS_05510) - 1129758..1130069 (+) 312 WP_305850508.1 YfhH family protein -
  ACFDHS_RS05515 (ACFDHS_05515) - 1130084..1131610 (+) 1527 WP_107633791.1 ATP-binding cassette domain-containing protein -
  ACFDHS_RS05520 (ACFDHS_05520) - 1131619..1132389 (+) 771 WP_039644826.1 teichoic acid translocation permease -
  ACFDHS_RS05525 (ACFDHS_05525) - 1132536..1133513 (-) 978 WP_107633792.1 metal-dependent hydrolase -
  ACFDHS_RS05530 (ACFDHS_05530) mutY 1133602..1134651 (+) 1050 WP_305850509.1 A/G-specific adenine glycosylase -
  ACFDHS_RS05535 (ACFDHS_05535) - 1134707..1135252 (+) 546 WP_107633794.1 DUF402 domain-containing protein -

Sequence


Protein


Download         Length: 209 a.a.        Molecular weight: 23540.17 Da        Isoelectric Point: 5.1671

>NTDB_id=1055741 ACFDHS_RS05355 WP_039644795.1 1103374..1104003(+) (vraR) [Staphylococcus hyicus strain SC362]
MTIKVLFVDDHEMVRIGISSYLSTQPDIEVVGEGASGKEAITKAHELQPDLILMDLVMTDMDGVEATTQIKKDLPRIKVV
MLTSYIEDKEVYRALDAGVDSYILKTTSASDIAEAIRKTHKGESVFEAEVLVKMRNRMRQRAELYELLTEREMEILLLIS
KGYSNQEIASASHITIKTVKTHVSNILSKLEVQDRTQAVIYAFQHGLIE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=1055741 ACFDHS_RS05355 WP_039644795.1 1103374..1104003(+) (vraR) [Staphylococcus hyicus strain SC362]
ATGACAATTAAAGTATTATTTGTGGATGATCATGAAATGGTAAGAATTGGAATATCAAGTTATCTTTCAACTCAACCAGA
TATTGAAGTAGTTGGTGAAGGAGCATCGGGTAAAGAAGCGATTACGAAGGCGCATGAACTTCAACCGGATTTGATTTTAA
TGGACTTAGTGATGACAGATATGGATGGTGTAGAAGCGACGACTCAAATTAAAAAAGATTTACCACGTATTAAAGTCGTG
ATGCTTACAAGCTATATTGAAGATAAAGAAGTTTACCGTGCGTTAGATGCAGGGGTGGACAGTTATATATTAAAAACAAC
AAGTGCAAGCGATATAGCCGAAGCAATTCGTAAAACACATAAAGGTGAATCTGTTTTTGAAGCTGAAGTACTAGTGAAAA
TGCGAAATCGTATGAGACAAAGAGCAGAACTTTATGAATTATTAACGGAACGTGAAATGGAAATATTGTTACTGATTTCC
AAAGGTTACTCAAATCAGGAAATTGCGAGTGCCTCTCATATTACGATAAAGACGGTAAAAACGCATGTCAGTAACATTTT
AAGTAAGCTTGAAGTACAAGACCGTACACAAGCAGTTATTTATGCCTTTCAACATGGCTTAATTGAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0A8HRY9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  vraR Staphylococcus aureus N315

90.431

100

0.904

  degU Bacillus subtilis subsp. subtilis str. 168

35.714

100

0.383


Multiple sequence alignment