Detailed information NTG1052170

Bioinformatically predicted

Overview

• Name: cipB
• Type: Regulator
• Locus tag: ACE2AN_RS02545
• Genome accession: NZ_CP169564
• Coordinates: 494582..494731 (+)
• Length: 49 a.a.
• NCBI ID: WP_001809846.1
• Uniprot ID: Q00MV6
• Organism: Streptococcus pneumoniae strain 6_2F1
• Function: indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation

Genomic Context

Location: 489582..499731

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACE2AN_RS02525	blpC	490071..490226 (-)	156	WP_000358814.1	quorum-sensing system pheromone BlpC	-
ACE2AN_RS02530	-	490283..491644 (-)	1362	WP_375060586.1	bacteriocin secretion accessory protein	-
ACE2AN_RS02535	comA/nlmT	491655..493808 (-)	2154	WP_375060587.1	peptide cleavage/export ABC transporter BlpA	Regulator
ACE2AN_RS02540	blpK	494090..494338 (+)	249	WP_000379965.1	bacteriocin-like peptide BlpK	-
ACE2AN_RS02545	cipB	494582..494731 (+)	150	WP_001809846.1	bacteriocin-like peptide BlpO	Regulator
ACE2AN_RS02550	-	494827..494946 (+)	120	WP_001833623.1	PncF family bacteriocin immunity protein	-
ACE2AN_RS02555	-	495672..496476 (+)	805	Protein_502	IS5 family transposase	-
ACE2AN_RS02560	blpM	496626..496880 (+)	255	WP_000379877.1	two-peptide bacteriocin subunit BlpM	-
ACE2AN_RS02565	blpN	496896..497099 (+)	204	WP_375060588.1	two-peptide bacteriocin subunit BlpN	-
ACE2AN_RS02570	-	497343..497576 (+)	234	WP_000379963.1	hypothetical protein	-
ACE2AN_RS02575	-	497608..498297 (+)	690	WP_000760523.1	CPBP family intramembrane glutamic endopeptidase	-
ACE2AN_RS02580	blpZ	498339..498572 (+)	234	WP_000276498.1	immunity protein BlpZ	-
ACE2AN_RS02585	-	498723..499334 (+)	612	WP_000394036.1	CPBP family intramembrane glutamic endopeptidase	-

Sequence

Protein

• Length: 49 a.a.
• Molecular weight: 5149.92 Da
• Isoelectric Point: 4.0439

>NTDB_id=1052170 ACE2AN_RS02545 WP_001809846.1 494582..494731(+) (cipB) [Streptococcus pneumoniae strain 6_2F1]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide

• Length: 150 bp

>NTDB_id=1052170 ACE2AN_RS02545 WP_001809846.1 494582..494731(+) (cipB) [Streptococcus pneumoniae strain 6_2F1]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

• Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc) (6-44)

3D structure

• AlphaFold DB: Q00MV6

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
cipB	Streptococcus mutans UA159	53.061	100	0.531