Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   ACE1EH_RS14700 Genome accession   NZ_CP169535
Coordinates   3011216..3011356 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain HJ-16     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3006216..3016356
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACE1EH_RS14675 (ACE1EH_14675) - 3006559..3006942 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  ACE1EH_RS14680 (ACE1EH_14680) comA 3006964..3007608 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  ACE1EH_RS14685 (ACE1EH_14685) comP 3007689..3009977 (-) 2289 WP_375004437.1 histidine kinase Regulator
  ACE1EH_RS14690 (ACE1EH_14690) comX 3009989..3010153 (-) 165 WP_007613432.1 competence pheromone ComX -
  ACE1EH_RS14695 (ACE1EH_14695) - 3010153..3011064 (-) 912 WP_007613433.1 polyprenyl synthetase family protein -
  ACE1EH_RS14700 (ACE1EH_14700) degQ 3011216..3011356 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  ACE1EH_RS14705 (ACE1EH_14705) - 3011822..3012163 (+) 342 WP_375004438.1 hypothetical protein -
  ACE1EH_RS14710 (ACE1EH_14710) - 3012170..3013393 (-) 1224 WP_082998526.1 EAL and HDOD domain-containing protein -
  ACE1EH_RS14715 (ACE1EH_14715) - 3013523..3014989 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  ACE1EH_RS14720 (ACE1EH_14720) - 3015007..3015558 (-) 552 WP_082998525.1 cysteine hydrolase family protein -
  ACE1EH_RS14725 (ACE1EH_14725) - 3015655..3016053 (-) 399 WP_003152031.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1051892 ACE1EH_RS14700 WP_003152043.1 3011216..3011356(-) (degQ) [Bacillus velezensis strain HJ-16]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1051892 ACE1EH_RS14700 WP_003152043.1 3011216..3011356(-) (degQ) [Bacillus velezensis strain HJ-16]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891


Multiple sequence alignment