Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ACETWW_RS14700 Genome accession   NZ_CP169072
Coordinates   3003712..3003852 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain T971     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2998712..3008852
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACETWW_RS14675 (ACETWW_14665) - 2999039..2999422 (-) 384 WP_012118312.1 hotdog fold thioesterase -
  ACETWW_RS14680 (ACETWW_14670) comA 2999444..3000088 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  ACETWW_RS14685 (ACETWW_14675) comP 3000169..3002475 (-) 2307 WP_374004610.1 sensor histidine kinase Regulator
  ACETWW_RS14690 (ACETWW_14680) comX 3002494..3002670 (-) 177 WP_015240484.1 competence pheromone ComX -
  ACETWW_RS14695 (ACETWW_14685) - 3002685..3003560 (-) 876 WP_025285191.1 polyprenyl synthetase family protein -
  ACETWW_RS14700 (ACETWW_14690) degQ 3003712..3003852 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  ACETWW_RS14705 (ACETWW_14695) - 3004317..3004658 (+) 342 WP_342794125.1 hypothetical protein -
  ACETWW_RS14710 (ACETWW_14700) - 3004665..3005888 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  ACETWW_RS14715 (ACETWW_14705) - 3006018..3007484 (-) 1467 WP_139134428.1 nicotinate phosphoribosyltransferase -
  ACETWW_RS14720 (ACETWW_14710) - 3007502..3008053 (-) 552 WP_025285193.1 cysteine hydrolase family protein -
  ACETWW_RS14725 (ACETWW_14715) - 3008150..3008548 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1049759 ACETWW_RS14700 WP_003152043.1 3003712..3003852(-) (degQ) [Bacillus velezensis strain T971]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1049759 ACETWW_RS14700 WP_003152043.1 3003712..3003852(-) (degQ) [Bacillus velezensis strain T971]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment