Detailed information NTG1049741

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: ACETWW_RS11760
• Genome accession: NZ_CP169072
• Coordinates: 2456244..2456681 (-)
• Length: 145 a.a.
• NCBI ID: WP_012117983.1
• Uniprot ID: -
• Organism: Bacillus velezensis strain T971
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2451244..2461681

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACETWW_RS11710 (ACETWW_11700)	sinI	2451629..2451802 (+)	174	WP_003153105.1	anti-repressor SinI	Regulator
ACETWW_RS11715 (ACETWW_11705)	sinR	2451836..2452171 (+)	336	WP_003153104.1	transcriptional regulator SinR	Regulator
ACETWW_RS11720 (ACETWW_11710)	tasA	2452219..2453004 (-)	786	WP_007408329.1	biofilm matrix protein TasA	-
ACETWW_RS11725 (ACETWW_11715)	sipW	2453069..2453653 (-)	585	WP_025284996.1	signal peptidase I SipW	-
ACETWW_RS11730 (ACETWW_11720)	tapA	2453625..2454296 (-)	672	WP_015240206.1	amyloid fiber anchoring/assembly protein TapA	-
ACETWW_RS11735 (ACETWW_11725)	-	2454555..2454884 (+)	330	WP_012117979.1	DUF3889 domain-containing protein	-
ACETWW_RS11740 (ACETWW_11730)	-	2454923..2455102 (-)	180	WP_003153093.1	YqzE family protein	-
ACETWW_RS11745 (ACETWW_11735)	comGG	2455159..2455536 (-)	378	WP_012117980.1	competence type IV pilus minor pilin ComGG	Machinery gene
ACETWW_RS11750 (ACETWW_11740)	comGF	2455537..2456037 (-)	501	WP_268892471.1	competence type IV pilus minor pilin ComGF	-
ACETWW_RS11755 (ACETWW_11745)	comGE	2455946..2456260 (-)	315	WP_012117982.1	competence type IV pilus minor pilin ComGE	-
ACETWW_RS11760 (ACETWW_11750)	comGD	2456244..2456681 (-)	438	WP_012117983.1	competence type IV pilus minor pilin ComGD	Machinery gene
ACETWW_RS11765 (ACETWW_11755)	comGC	2456671..2456979 (-)	309	WP_003153087.1	competence type IV pilus major pilin ComGC	Machinery gene
ACETWW_RS11770 (ACETWW_11760)	comGB	2456984..2458021 (-)	1038	WP_374004326.1	competence type IV pilus assembly protein ComGB	Machinery gene
ACETWW_RS11775 (ACETWW_11765)	comGA	2458008..2459078 (-)	1071	WP_085342191.1	competence type IV pilus ATPase ComGA	Machinery gene
ACETWW_RS11780 (ACETWW_11770)	-	2459275..2460225 (-)	951	WP_007408319.1	magnesium transporter CorA family protein	-
ACETWW_RS11785 (ACETWW_11775)	-	2460371..2461672 (+)	1302	WP_021494315.1	hemolysin family protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16286.74 Da
• Isoelectric Point: 10.2475

>NTDB_id=1049741 ACETWW_RS11760 WP_012117983.1 2456244..2456681(-) (comGD) [Bacillus velezensis strain T971]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide

• Length: 438 bp

>NTDB_id=1049741 ACETWW_RS11760 WP_012117983.1 2456244..2456681(-) (comGD) [Bacillus velezensis strain T971]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGACTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	56.849	100	0.572