Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ACETWW_RS11710 | Genome accession | NZ_CP169072 |
| Coordinates | 2451629..2451802 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain T971 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2446629..2456802
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACETWW_RS11695 (ACETWW_11685) | gcvT | 2447442..2448542 (-) | 1101 | WP_025284994.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ACETWW_RS11700 (ACETWW_11690) | - | 2448966..2450636 (+) | 1671 | WP_072589380.1 | DEAD/DEAH box helicase | - |
| ACETWW_RS11705 (ACETWW_11695) | - | 2450658..2451452 (+) | 795 | WP_015240204.1 | YqhG family protein | - |
| ACETWW_RS11710 (ACETWW_11700) | sinI | 2451629..2451802 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| ACETWW_RS11715 (ACETWW_11705) | sinR | 2451836..2452171 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ACETWW_RS11720 (ACETWW_11710) | tasA | 2452219..2453004 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| ACETWW_RS11725 (ACETWW_11715) | sipW | 2453069..2453653 (-) | 585 | WP_025284996.1 | signal peptidase I SipW | - |
| ACETWW_RS11730 (ACETWW_11720) | tapA | 2453625..2454296 (-) | 672 | WP_015240206.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ACETWW_RS11735 (ACETWW_11725) | - | 2454555..2454884 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| ACETWW_RS11740 (ACETWW_11730) | - | 2454923..2455102 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| ACETWW_RS11745 (ACETWW_11735) | comGG | 2455159..2455536 (-) | 378 | WP_012117980.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ACETWW_RS11750 (ACETWW_11740) | comGF | 2455537..2456037 (-) | 501 | WP_268892471.1 | competence type IV pilus minor pilin ComGF | - |
| ACETWW_RS11755 (ACETWW_11745) | comGE | 2455946..2456260 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| ACETWW_RS11760 (ACETWW_11750) | comGD | 2456244..2456681 (-) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1049738 ACETWW_RS11710 WP_003153105.1 2451629..2451802(+) (sinI) [Bacillus velezensis strain T971]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1049738 ACETWW_RS11710 WP_003153105.1 2451629..2451802(+) (sinI) [Bacillus velezensis strain T971]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |