Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ACETWW_RS11710 Genome accession   NZ_CP169072
Coordinates   2451629..2451802 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain T971     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2446629..2456802
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACETWW_RS11695 (ACETWW_11685) gcvT 2447442..2448542 (-) 1101 WP_025284994.1 glycine cleavage system aminomethyltransferase GcvT -
  ACETWW_RS11700 (ACETWW_11690) - 2448966..2450636 (+) 1671 WP_072589380.1 DEAD/DEAH box helicase -
  ACETWW_RS11705 (ACETWW_11695) - 2450658..2451452 (+) 795 WP_015240204.1 YqhG family protein -
  ACETWW_RS11710 (ACETWW_11700) sinI 2451629..2451802 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACETWW_RS11715 (ACETWW_11705) sinR 2451836..2452171 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACETWW_RS11720 (ACETWW_11710) tasA 2452219..2453004 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  ACETWW_RS11725 (ACETWW_11715) sipW 2453069..2453653 (-) 585 WP_025284996.1 signal peptidase I SipW -
  ACETWW_RS11730 (ACETWW_11720) tapA 2453625..2454296 (-) 672 WP_015240206.1 amyloid fiber anchoring/assembly protein TapA -
  ACETWW_RS11735 (ACETWW_11725) - 2454555..2454884 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  ACETWW_RS11740 (ACETWW_11730) - 2454923..2455102 (-) 180 WP_003153093.1 YqzE family protein -
  ACETWW_RS11745 (ACETWW_11735) comGG 2455159..2455536 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACETWW_RS11750 (ACETWW_11740) comGF 2455537..2456037 (-) 501 WP_268892471.1 competence type IV pilus minor pilin ComGF -
  ACETWW_RS11755 (ACETWW_11745) comGE 2455946..2456260 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  ACETWW_RS11760 (ACETWW_11750) comGD 2456244..2456681 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=1049738 ACETWW_RS11710 WP_003153105.1 2451629..2451802(+) (sinI) [Bacillus velezensis strain T971]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1049738 ACETWW_RS11710 WP_003153105.1 2451629..2451802(+) (sinI) [Bacillus velezensis strain T971]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702


Multiple sequence alignment