Detailed information    

insolico Bioinformatically predicted

Overview

Name   CJE0566   Type   Regulator
Locus tag   R8612_RS04325 Genome accession   NZ_AP028351
Coordinates   861755..862417 (+) Length   220 a.a.
NCBI ID   WP_317647493.1    Uniprot ID   -
Organism   Campylobacter coli strain BCH-10460     
Function   repress natural transformation (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 833811..878609 861755..862417 within 0


Gene organization within MGE regions


Location: 833811..878609
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R8612_RS04145 (B10460_08210) - 833811..834710 (-) 900 WP_002805646.1 P-loop NTPase fold protein -
  R8612_RS04150 (B10460_08220) - 834746..835162 (-) 417 WP_002778951.1 P-loop NTPase fold protein -
  R8612_RS04155 (B10460_08230) - 835691..837421 (-) 1731 WP_317647484.1 hypothetical protein -
  R8612_RS04160 (B10460_08240) - 837421..837912 (-) 492 WP_233931626.1 hypothetical protein -
  R8612_RS04165 (B10460_08250) - 837905..838123 (-) 219 WP_002827419.1 hypothetical protein -
  R8612_RS04170 (B10460_08260) - 838056..838460 (-) 405 WP_002827418.1 hypothetical protein -
  R8612_RS04175 (B10460_08270) - 838457..838933 (-) 477 WP_002873429.1 DUF5675 family protein -
  R8612_RS04180 (B10460_08280) - 838923..839396 (-) 474 WP_002792595.1 hypothetical protein -
  R8612_RS04185 (B10460_08290) - 839393..839773 (-) 381 WP_317647485.1 hypothetical protein -
  R8612_RS04190 (B10460_08300) - 839770..840405 (-) 636 WP_002873428.1 DUF4376 domain-containing protein -
  R8612_RS04195 (B10460_08310) - 840418..840867 (-) 450 WP_002875080.1 hypothetical protein -
  R8612_RS04200 (B10460_08320) - 840869..841831 (-) 963 WP_317647486.1 hypothetical protein -
  R8612_RS04205 (B10460_08330) - 841835..843496 (-) 1662 WP_317647487.1 hypothetical protein -
  R8612_RS04210 (B10460_08340) - 843499..843693 (-) 195 WP_002782214.1 hypothetical protein -
  R8612_RS04215 (B10460_08350) - 843674..844078 (-) 405 WP_002861675.1 hypothetical protein -
  R8612_RS04220 (B10460_08360) - 844078..845112 (-) 1035 WP_011049719.1 DUF5309 family protein -
  R8612_RS04225 (B10460_08370) - 845190..845858 (-) 669 WP_002784032.1 Rha family transcriptional regulator -
  R8612_RS04230 (B10460_08380) - 846035..846832 (+) 798 WP_002784031.1 hypothetical protein -
  R8612_RS04235 (B10460_08390) - 847198..850830 (-) 3633 WP_317647488.1 hypothetical protein -
  R8612_RS04240 (B10460_08400) - 850827..852041 (-) 1215 WP_317647489.1 hypothetical protein -
  R8612_RS04245 (B10460_08410) - 852301..852681 (-) 381 WP_002791792.1 hypothetical protein -
  R8612_RS04250 (B10460_08420) - 852692..853339 (-) 648 WP_070292604.1 hypothetical protein -
  R8612_RS04255 (B10460_08430) - 853329..853532 (-) 204 WP_002795623.1 hypothetical protein -
  R8612_RS04260 (B10460_08440) - 853525..855063 (-) 1539 WP_233931615.1 hypothetical protein -
  R8612_RS04265 (B10460_08450) - 855044..855316 (-) 273 WP_002781524.1 hypothetical protein -
  R8612_RS04270 (B10460_08460) - 855306..856598 (-) 1293 WP_072213959.1 terminase large subunit domain-containing protein -
  R8612_RS04275 (B10460_08470) - 856595..856981 (-) 387 WP_002795630.1 terminase small subunit -
  R8612_RS04280 (B10460_08480) - 856981..857361 (-) 381 WP_002810222.1 hypothetical protein -
  R8612_RS04285 (B10460_08490) - 857379..858029 (-) 651 WP_227571201.1 hypothetical protein -
  R8612_RS04290 (B10460_08500) - 858040..859041 (-) 1002 WP_052800584.1 hypothetical protein -
  R8612_RS04295 - 859084..859449 (+) 366 WP_002784008.1 hypothetical protein -
  R8612_RS04300 (B10460_08530) - 859585..859734 (+) 150 WP_002785586.1 hypothetical protein -
  R8612_RS04305 (B10460_08540) - 859731..859919 (-) 189 WP_057038126.1 hypothetical protein -
  R8612_RS04310 (B10460_08550) - 859916..860149 (-) 234 WP_072235911.1 hypothetical protein -
  R8612_RS04315 (B10460_08560) - 860260..860931 (+) 672 WP_052780014.1 LexA family transcriptional regulator -
  R8612_RS04320 (B10460_08570) - 860962..861735 (+) 774 WP_284107926.1 hypothetical protein -
  R8612_RS04325 (B10460_08580) CJE0566 861755..862417 (+) 663 WP_317647493.1 DNA/RNA non-specific endonuclease Regulator
  R8612_RS04330 (B10460_08590) - 862483..862986 (+) 504 WP_002840261.1 Panacea domain-containing protein -
  R8612_RS04335 (B10460_08600) - 862973..863248 (+) 276 WP_002840259.1 hypothetical protein -
  R8612_RS04340 (B10460_08610) - 863260..864030 (-) 771 WP_317647357.1 SEL1-like repeat protein -
  R8612_RS04345 (B10460_08620) - 864034..864726 (-) 693 WP_223207056.1 hypothetical protein -
  R8612_RS04350 (B10460_08630) - 864879..865151 (+) 273 WP_002786773.1 hypothetical protein -
  R8612_RS04355 (B10460_08640) - 865735..866004 (+) 270 WP_002783984.1 hypothetical protein -
  R8612_RS04360 (B10460_08650) - 865995..866252 (+) 258 WP_002786782.1 hypothetical protein -
  R8612_RS04365 (B10460_08660) - 866243..866470 (+) 228 WP_002783979.1 helix-turn-helix domain-containing protein -
  R8612_RS04370 (B10460_08670) - 866472..867326 (+) 855 WP_071169374.1 lambda exonuclease family protein -
  R8612_RS04375 (B10460_08680) - 867328..868260 (+) 933 WP_038402058.1 recombinase RecT -
  R8612_RS04380 (B10460_08690) - 868260..868955 (+) 696 WP_052798820.1 hypothetical protein -
  R8612_RS04385 (B10460_08700) - 868936..869214 (+) 279 WP_153260492.1 hypothetical protein -
  R8612_RS04390 (B10460_08710) - 869195..869611 (+) 417 WP_153260428.1 YopX family protein -
  R8612_RS04395 (B10460_08720) - 869616..870158 (+) 543 WP_173777443.1 sugar-phosphate nucleotidyltransferase -
  R8612_RS04400 (B10460_08730) - 870183..870596 (+) 414 WP_153260429.1 YopX family protein -
  R8612_RS04405 (B10460_08740) - 870596..870739 (+) 144 WP_153260430.1 hypothetical protein -
  R8612_RS04410 (B10460_08750) - 870775..871068 (+) 294 WP_002873572.1 hypothetical protein -
  R8612_RS04415 (B10460_08760) - 871078..871311 (+) 234 WP_002782536.1 hypothetical protein -
  R8612_RS04420 (B10460_08770) - 871308..871685 (+) 378 WP_002782538.1 hypothetical protein -
  R8612_RS04425 (B10460_08780) - 871834..872079 (+) 246 WP_070234833.1 hypothetical protein -
  R8612_RS04430 (B10460_08790) - 872121..872276 (+) 156 WP_148116483.1 toxin-antitoxin system HicB family antitoxin -
  R8612_RS04435 (B10460_08800) - 872406..873086 (+) 681 WP_317647358.1 antA/AntB antirepressor family protein -
  R8612_RS04440 (B10460_08810) - 873088..873630 (+) 543 WP_038836813.1 pentapeptide repeat-containing protein -
  R8612_RS09060 (B10460_08820) - 873623..873862 (+) 240 WP_002811742.1 helix-turn-helix domain-containing protein -
  R8612_RS04445 (B10460_08830) - 873789..874988 (-) 1200 WP_173777336.1 site-specific integrase -
  R8612_RS04455 (B10460_08840) - 875328..875666 (-) 339 WP_002785015.1 F0F1 ATP synthase subunit C -
  R8612_RS04460 (B10460_08850) - 875912..877246 (+) 1335 WP_002785017.1 sodium-dependent transporter -
  R8612_RS04465 (B10460_08860) - 877260..878609 (+) 1350 WP_002790562.1 sodium-dependent transporter -

Sequence

Protein


Download         Length: 220 a.a.        Molecular weight: 25683.26 Da        Isoelectric Point: 9.8596

>NTDB_id=104628 R8612_RS04325 WP_317647493.1 861755..862417(+) (CJE0566) [Campylobacter coli strain BCH-10460]
MKKLILLPLLSTLAFADYTQYKPSEDFAKYLTKQNCSQVLDKFYYLNCYDYNLKGTKAVAYKLEAENLKGEQIKKHPRFE
DDTNIPKKYRTTWSDYKNSGYDRGHTLSNASMRKTTQAQRSTFLMSNITPQNPQINQKVWNKIEKRERQAALKLGSLEVL
NLVNYDNNPQRIRNQIAIPSSYTKILKGENFKECYQVPNHKVENENIKNYKVNCDILTGS

Nucleotide


Download         Length: 663 bp        

>NTDB_id=104628 R8612_RS04325 WP_317647493.1 861755..862417(+) (CJE0566) [Campylobacter coli strain BCH-10460]
GTGAAAAAACTCATACTTTTACCATTGTTATCCACTCTAGCTTTTGCTGACTATACGCAATATAAGCCAAGCGAAGATTT
TGCTAAGTATTTGACTAAGCAAAACTGCTCACAAGTTTTAGATAAGTTTTATTATCTAAATTGTTATGATTATAATCTTA
AAGGCACTAAAGCTGTAGCTTATAAACTAGAAGCGGAAAATTTAAAAGGCGAACAAATCAAAAAACACCCACGCTTTGAA
GATGATACAAATATACCTAAAAAATACCGCACCACATGGAGTGATTATAAAAACAGCGGTTATGATAGAGGGCACACTCT
TTCTAATGCTTCAATGAGAAAAACAACTCAAGCCCAAAGAAGCACTTTTTTAATGAGTAATATTACTCCACAAAATCCAC
AAATTAATCAAAAAGTATGGAATAAGATTGAAAAAAGAGAAAGACAAGCAGCTTTGAAGCTTGGAAGTTTAGAGGTTTTG
AATTTAGTTAATTATGACAATAATCCACAAAGAATAAGAAATCAAATTGCCATTCCAAGCTCTTACACTAAGATTTTAAA
AGGCGAGAATTTTAAAGAATGTTATCAAGTGCCAAATCATAAAGTAGAAAATGAGAATATAAAAAATTATAAGGTTAATT
GTGATATTTTAACCGGCAGTTGA

Domains

Predicted by InterproScan.

DNA/RNA non-specific endonuclease (Endonuclease_NS)

(27-215)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  CJE0566 Campylobacter jejuni RM1221

92.558

97.727

0.905
  CJE1441 Campylobacter jejuni RM1221

91.628

97.727

0.895

Multiple sequence alignment