Detailed information NTG1042622

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: ACEF29_RS13055
• Genome accession: NZ_CP168150
• Coordinates: 2637452..2637889 (-)
• Length: 145 a.a.
• NCBI ID: WP_012117983.1
• Uniprot ID: -
• Organism: Bacillus velezensis strain CM19
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2632452..2642889

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACEF29_RS13005 (ACEF29_13005)	sinI	2632836..2633009 (+)	174	WP_003153105.1	anti-repressor SinI	Regulator
ACEF29_RS13010 (ACEF29_13010)	sinR	2633043..2633378 (+)	336	WP_003153104.1	transcriptional regulator SinR	Regulator
ACEF29_RS13015 (ACEF29_13015)	tasA	2633426..2634211 (-)	786	WP_007408329.1	biofilm matrix protein TasA	-
ACEF29_RS13020 (ACEF29_13020)	sipW	2634276..2634860 (-)	585	WP_015240205.1	signal peptidase I SipW	-
ACEF29_RS13025 (ACEF29_13025)	tapA	2634832..2635503 (-)	672	WP_053573199.1	amyloid fiber anchoring/assembly protein TapA	-
ACEF29_RS13030 (ACEF29_13030)	-	2635762..2636091 (+)	330	WP_039254490.1	DUF3889 domain-containing protein	-
ACEF29_RS13035 (ACEF29_13035)	-	2636131..2636310 (-)	180	WP_003153093.1	YqzE family protein	-
ACEF29_RS13040 (ACEF29_13040)	comGG	2636367..2636744 (-)	378	WP_015417814.1	competence type IV pilus minor pilin ComGG	Machinery gene
ACEF29_RS13045 (ACEF29_13045)	comGF	2636745..2637245 (-)	501	WP_256052909.1	competence type IV pilus minor pilin ComGF	-
ACEF29_RS13050 (ACEF29_13050)	comGE	2637154..2637468 (-)	315	WP_012117982.1	competence type IV pilus minor pilin ComGE	-
ACEF29_RS13055 (ACEF29_13055)	comGD	2637452..2637889 (-)	438	WP_012117983.1	competence type IV pilus minor pilin ComGD	Machinery gene
ACEF29_RS13060 (ACEF29_13060)	comGC	2637879..2638187 (-)	309	WP_079979070.1	competence type IV pilus major pilin ComGC	Machinery gene
ACEF29_RS13065 (ACEF29_13065)	comGB	2638192..2639229 (-)	1038	WP_053573197.1	competence type IV pilus assembly protein ComGB	Machinery gene
ACEF29_RS13070 (ACEF29_13070)	comGA	2639216..2640286 (-)	1071	WP_053573196.1	competence type IV pilus ATPase ComGA	Machinery gene
ACEF29_RS13075 (ACEF29_13075)	-	2640479..2641429 (-)	951	WP_015417820.1	magnesium transporter CorA family protein	-
ACEF29_RS13080 (ACEF29_13080)	-	2641575..2642876 (+)	1302	WP_012117986.1	hemolysin family protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16286.74 Da
• Isoelectric Point: 10.2475

>NTDB_id=1042622 ACEF29_RS13055 WP_012117983.1 2637452..2637889(-) (comGD) [Bacillus velezensis strain CM19]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide

• Length: 438 bp

>NTDB_id=1042622 ACEF29_RS13055 WP_012117983.1 2637452..2637889(-) (comGD) [Bacillus velezensis strain CM19]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGTCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCCTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATCCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	56.849	100	0.572