Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ACEF29_RS13005 | Genome accession | NZ_CP168150 |
| Coordinates | 2632836..2633009 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain CM19 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2627836..2638009
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACEF29_RS12990 (ACEF29_12990) | gcvT | 2628649..2629749 (-) | 1101 | WP_053573200.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ACEF29_RS12995 (ACEF29_12995) | - | 2630173..2631843 (+) | 1671 | WP_031378948.1 | DEAD/DEAH box helicase | - |
| ACEF29_RS13000 (ACEF29_13000) | - | 2631865..2632659 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| ACEF29_RS13005 (ACEF29_13005) | sinI | 2632836..2633009 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| ACEF29_RS13010 (ACEF29_13010) | sinR | 2633043..2633378 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ACEF29_RS13015 (ACEF29_13015) | tasA | 2633426..2634211 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| ACEF29_RS13020 (ACEF29_13020) | sipW | 2634276..2634860 (-) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| ACEF29_RS13025 (ACEF29_13025) | tapA | 2634832..2635503 (-) | 672 | WP_053573199.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ACEF29_RS13030 (ACEF29_13030) | - | 2635762..2636091 (+) | 330 | WP_039254490.1 | DUF3889 domain-containing protein | - |
| ACEF29_RS13035 (ACEF29_13035) | - | 2636131..2636310 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| ACEF29_RS13040 (ACEF29_13040) | comGG | 2636367..2636744 (-) | 378 | WP_015417814.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ACEF29_RS13045 (ACEF29_13045) | comGF | 2636745..2637245 (-) | 501 | WP_256052909.1 | competence type IV pilus minor pilin ComGF | - |
| ACEF29_RS13050 (ACEF29_13050) | comGE | 2637154..2637468 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| ACEF29_RS13055 (ACEF29_13055) | comGD | 2637452..2637889 (-) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1042619 ACEF29_RS13005 WP_003153105.1 2632836..2633009(+) (sinI) [Bacillus velezensis strain CM19]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1042619 ACEF29_RS13005 WP_003153105.1 2632836..2633009(+) (sinI) [Bacillus velezensis strain CM19]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |