Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   ACDZ81_RS13045 Genome accession   NZ_CP168028
Coordinates   2636367..2636744 (-) Length   125 a.a.
NCBI ID   WP_015417814.1    Uniprot ID   -
Organism   Bacillus velezensis strain CM5 isolate     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2631367..2641744
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACDZ81_RS13005 (ACDZ81_13005) - 2631865..2632659 (+) 795 WP_007408330.1 YqhG family protein -
  ACDZ81_RS13010 (ACDZ81_13010) sinI 2632836..2633009 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACDZ81_RS13015 (ACDZ81_13015) sinR 2633043..2633378 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACDZ81_RS13020 (ACDZ81_13020) tasA 2633426..2634211 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  ACDZ81_RS13025 (ACDZ81_13025) sipW 2634276..2634860 (-) 585 WP_015240205.1 signal peptidase I SipW -
  ACDZ81_RS13030 (ACDZ81_13030) tapA 2634832..2635503 (-) 672 WP_053573199.1 amyloid fiber anchoring/assembly protein TapA -
  ACDZ81_RS13035 (ACDZ81_13035) - 2635762..2636091 (+) 330 WP_039254490.1 DUF3889 domain-containing protein -
  ACDZ81_RS13040 (ACDZ81_13040) - 2636131..2636310 (-) 180 WP_003153093.1 YqzE family protein -
  ACDZ81_RS13045 (ACDZ81_13045) comGG 2636367..2636744 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACDZ81_RS13050 (ACDZ81_13050) comGF 2636745..2637245 (-) 501 WP_256052909.1 competence type IV pilus minor pilin ComGF -
  ACDZ81_RS13055 (ACDZ81_13055) comGE 2637154..2637468 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  ACDZ81_RS13060 (ACDZ81_13060) comGD 2637452..2637889 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACDZ81_RS13065 (ACDZ81_13065) comGC 2637879..2638187 (-) 309 WP_079979070.1 competence type IV pilus major pilin ComGC Machinery gene
  ACDZ81_RS13070 (ACDZ81_13070) comGB 2638192..2639229 (-) 1038 WP_053573197.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACDZ81_RS13075 (ACDZ81_13075) comGA 2639216..2640286 (-) 1071 WP_053573196.1 competence type IV pilus ATPase ComGA Machinery gene
  ACDZ81_RS13080 (ACDZ81_13080) - 2640479..2641429 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14167.09 Da        Isoelectric Point: 9.7165

>NTDB_id=1041632 ACDZ81_RS13045 WP_015417814.1 2636367..2636744(-) (comGG) [Bacillus velezensis strain CM5 isolate]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=1041632 ACDZ81_RS13045 WP_015417814.1 2636367..2636744(-) (comGG) [Bacillus velezensis strain CM5 isolate]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAATACTGGATCGGAGAGAACTTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504


Multiple sequence alignment