Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   ACDZ80_RS16540 Genome accession   NZ_CP168027
Coordinates   3276671..3276811 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain CM35 isolate     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3271671..3281811
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACDZ80_RS16520 (ACDZ80_16520) - 3271968..3272351 (-) 384 WP_053574130.1 hotdog fold thioesterase -
  ACDZ80_RS16525 (ACDZ80_16525) comA 3272373..3273017 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  ACDZ80_RS16530 (ACDZ80_16530) comP 3273098..3275401 (-) 2304 WP_373265359.1 histidine kinase Regulator
  ACDZ80_RS16535 (ACDZ80_16535) comQ 3275554..3276540 (-) 987 WP_269195024.1 class 1 isoprenoid biosynthesis enzyme Regulator
  ACDZ80_RS16540 (ACDZ80_16540) degQ 3276671..3276811 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  ACDZ80_RS16545 (ACDZ80_16545) - 3277274..3277615 (+) 342 WP_007408677.1 hypothetical protein -
  ACDZ80_RS16550 (ACDZ80_16550) - 3277622..3278845 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  ACDZ80_RS16555 (ACDZ80_16555) - 3278975..3280441 (-) 1467 WP_015418109.1 nicotinate phosphoribosyltransferase -
  ACDZ80_RS16560 (ACDZ80_16560) - 3280459..3281010 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  ACDZ80_RS16565 (ACDZ80_16565) - 3281107..3281505 (-) 399 WP_003152031.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1041575 ACDZ80_RS16540 WP_003152043.1 3276671..3276811(-) (degQ) [Bacillus velezensis strain CM35 isolate]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1041575 ACDZ80_RS16540 WP_003152043.1 3276671..3276811(-) (degQ) [Bacillus velezensis strain CM35 isolate]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891


Multiple sequence alignment