Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   ACCO40_RS12485 Genome accession   NZ_CP167793
Coordinates   2454161..2454508 (-) Length   115 a.a.
NCBI ID   WP_372401667.1    Uniprot ID   -
Organism   Bacillus spizizenii strain SHT-15     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2449161..2459508
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACCO40_RS12440 (ACCO40_12440) sinI 2449689..2449862 (+) 174 WP_003226347.1 anti-repressor SinI Regulator
  ACCO40_RS12445 (ACCO40_12445) sinR 2449896..2450231 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ACCO40_RS12450 (ACCO40_12450) tasA 2450325..2451110 (-) 786 WP_014114390.1 biofilm matrix protein TasA -
  ACCO40_RS12455 (ACCO40_12455) sipW 2451174..2451746 (-) 573 WP_372402795.1 signal peptidase I SipW -
  ACCO40_RS12460 (ACCO40_12460) tapA 2451730..2452491 (-) 762 WP_072566543.1 amyloid fiber anchoring/assembly protein TapA -
  ACCO40_RS12465 (ACCO40_12465) - 2452762..2453088 (+) 327 WP_014114393.1 YqzG/YhdC family protein -
  ACCO40_RS12470 (ACCO40_12470) - 2453126..2453305 (-) 180 WP_372401661.1 YqzE family protein -
  ACCO40_RS12475 (ACCO40_12475) comGG 2453377..2453751 (-) 375 WP_072183695.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACCO40_RS12480 (ACCO40_12480) comGF 2453752..2454135 (-) 384 WP_372401664.1 competence type IV pilus minor pilin ComGF Machinery gene
  ACCO40_RS12485 (ACCO40_12485) comGE 2454161..2454508 (-) 348 WP_372401667.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACCO40_RS12490 (ACCO40_12490) comGD 2454492..2454923 (-) 432 WP_326198324.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACCO40_RS12495 (ACCO40_12495) comGC 2454913..2455209 (-) 297 WP_014114400.1 comG operon protein ComGC Machinery gene
  ACCO40_RS12500 (ACCO40_12500) comGB 2455223..2456260 (-) 1038 WP_372401671.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACCO40_RS12505 (ACCO40_12505) comGA 2456247..2457317 (-) 1071 WP_072183690.1 competence protein ComGA Machinery gene
  ACCO40_RS12510 (ACCO40_12510) - 2457531..2457942 (-) 412 Protein_2414 CBS domain-containing protein -
  ACCO40_RS12515 (ACCO40_12515) - 2458005..2458952 (-) 948 WP_242734002.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 115 a.a.        Molecular weight: 13418.37 Da        Isoelectric Point: 4.4012

>NTDB_id=1039424 ACCO40_RS12485 WP_372401667.1 2454161..2454508(-) (comGE) [Bacillus spizizenii strain SHT-15]
MWRENKGFSTIETMSALSLWLFLLLTVVPLWDKLIADENMTKSREIGYQMMNESISKYMMTGEGTNMKTVTNDDNNYTLK
WEEEGEYQNVCISAAAYKEKPFCLSILRTDWLYAS

Nucleotide


Download         Length: 348 bp        

>NTDB_id=1039424 ACCO40_RS12485 WP_372401667.1 2454161..2454508(-) (comGE) [Bacillus spizizenii strain SHT-15]
ATGTGGAGAGAAAATAAAGGTTTTTCTACAATAGAAACAATGTCTGCGCTAAGCCTGTGGCTGTTTCTGCTGCTGACAGT
CGTTCCTTTATGGGACAAGCTGATAGCTGATGAAAATATGACGAAATCTCGAGAAATCGGCTACCAAATGATGAATGAAA
GCATTAGCAAATATATGATGACTGGTGAAGGAACTAATATGAAAACGGTTACAAATGACGATAATAACTATACGCTAAAG
TGGGAGGAGGAGGGGGAATATCAAAACGTATGCATCTCAGCAGCAGCTTATAAAGAAAAACCATTTTGCCTCAGTATTCT
GCGGACAGACTGGCTATACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

80

100

0.8

Multiple sequence alignment