Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   ACCO40_RS12440 Genome accession   NZ_CP167793
Coordinates   2449689..2449862 (+) Length   57 a.a.
NCBI ID   WP_003226347.1    Uniprot ID   G4NQ83
Organism   Bacillus spizizenii strain SHT-15     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2444689..2454862
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACCO40_RS12425 (ACCO40_12425) gcvT 2445484..2446572 (-) 1089 WP_072183732.1 glycine cleavage system aminomethyltransferase GcvT -
  ACCO40_RS12430 (ACCO40_12430) - 2447015..2448688 (+) 1674 WP_087986881.1 DEAD/DEAH box helicase -
  ACCO40_RS12435 (ACCO40_12435) - 2448709..2449503 (+) 795 WP_090558097.1 YqhG family protein -
  ACCO40_RS12440 (ACCO40_12440) sinI 2449689..2449862 (+) 174 WP_003226347.1 anti-repressor SinI Regulator
  ACCO40_RS12445 (ACCO40_12445) sinR 2449896..2450231 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ACCO40_RS12450 (ACCO40_12450) tasA 2450325..2451110 (-) 786 WP_014114390.1 biofilm matrix protein TasA -
  ACCO40_RS12455 (ACCO40_12455) sipW 2451174..2451746 (-) 573 WP_372402795.1 signal peptidase I SipW -
  ACCO40_RS12460 (ACCO40_12460) tapA 2451730..2452491 (-) 762 WP_072566543.1 amyloid fiber anchoring/assembly protein TapA -
  ACCO40_RS12465 (ACCO40_12465) - 2452762..2453088 (+) 327 WP_014114393.1 YqzG/YhdC family protein -
  ACCO40_RS12470 (ACCO40_12470) - 2453126..2453305 (-) 180 WP_372401661.1 YqzE family protein -
  ACCO40_RS12475 (ACCO40_12475) comGG 2453377..2453751 (-) 375 WP_072183695.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACCO40_RS12480 (ACCO40_12480) comGF 2453752..2454135 (-) 384 WP_372401664.1 competence type IV pilus minor pilin ComGF Machinery gene
  ACCO40_RS12485 (ACCO40_12485) comGE 2454161..2454508 (-) 348 WP_372401667.1 competence type IV pilus minor pilin ComGE Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6632.64 Da        Isoelectric Point: 8.6596

>NTDB_id=1039420 ACCO40_RS12440 WP_003226347.1 2449689..2449862(+) (sinI) [Bacillus spizizenii strain SHT-15]
MKNAKQEHFELDQEWVELMMKAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1039420 ACCO40_RS12440 WP_003226347.1 2449689..2449862(+) (sinI) [Bacillus spizizenii strain SHT-15]
ATGAAAAATGCAAAACAAGAGCACTTCGAATTAGATCAAGAATGGGTTGAATTAATGATGAAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4NQ83

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

96.491

100

0.965

Multiple sequence alignment