Detailed information
Bioinformatically predicted
Overview
| Name | degQ | Type | Regulator |
| Locus tag | ACBW56_RS18265 | Genome accession | NZ_CP167196 |
| Coordinates | 3686459..3686599 (+) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain FRI-TD24 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3681459..3691599
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACBW56_RS18240 (ACBW56_18240) | - | 3681765..3682163 (+) | 399 | WP_003152031.1 | YueI family protein | - |
| ACBW56_RS18245 (ACBW56_18245) | - | 3682260..3682811 (+) | 552 | WP_003152033.1 | cysteine hydrolase family protein | - |
| ACBW56_RS18250 (ACBW56_18250) | - | 3682829..3684295 (+) | 1467 | WP_014305722.1 | nicotinate phosphoribosyltransferase | - |
| ACBW56_RS18255 (ACBW56_18255) | - | 3684425..3685645 (+) | 1221 | WP_003152038.1 | EAL and HDOD domain-containing protein | - |
| ACBW56_RS18260 (ACBW56_18260) | - | 3685652..3685993 (-) | 342 | WP_014305721.1 | hypothetical protein | - |
| ACBW56_RS18265 (ACBW56_18265) | degQ | 3686459..3686599 (+) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| ACBW56_RS18270 (ACBW56_18270) | - | 3686807..3687667 (+) | 861 | WP_159073777.1 | polyprenyl synthetase family protein | - |
| ACBW56_RS18275 (ACBW56_18275) | comX | 3687636..3687809 (+) | 174 | WP_012118314.1 | competence pheromone ComX | - |
| ACBW56_RS18280 (ACBW56_18280) | comP | 3687823..3690123 (+) | 2301 | WP_330728972.1 | histidine kinase | Regulator |
| ACBW56_RS18285 (ACBW56_18285) | comA | 3690204..3690848 (+) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| ACBW56_RS18290 (ACBW56_18290) | - | 3690870..3691253 (+) | 384 | WP_003152054.1 | hotdog fold thioesterase | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=1038801 ACBW56_RS18265 WP_003152043.1 3686459..3686599(+) (degQ) [Bacillus velezensis strain FRI-TD24]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=1038801 ACBW56_RS18265 WP_003152043.1 3686459..3686599(+) (degQ) [Bacillus velezensis strain FRI-TD24]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |