Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   KJP53_RS16350 Genome accession   NZ_OX419551
Coordinates   3144839..3145006 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   A8D470
Organism   Bacillus subtilis isolate NRS6190     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3139839..3150006
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP53_RS16320 (NRS6190_16195) mrpE 3140234..3140710 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  KJP53_RS16325 (NRS6190_16200) mrpF 3140710..3140994 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  KJP53_RS16330 (NRS6190_16205) mnhG 3140978..3141352 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  KJP53_RS16335 (NRS6190_16210) yuxO 3141391..3141771 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  KJP53_RS16340 (NRS6190_16215) comA 3141790..3142434 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  KJP53_RS16345 (NRS6190_16220) comP 3142515..3144824 (-) 2310 WP_015251333.1 two-component system sensor histidine kinase ComP Regulator
  KJP53_RS16350 (NRS6190_16225) comX 3144839..3145006 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  KJP53_RS16355 (NRS6190_16230) comQ 3144994..3145893 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  KJP53_RS16360 (NRS6190_16235) degQ 3146078..3146218 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  KJP53_RS16365 - 3146440..3146565 (+) 126 WP_003228793.1 hypothetical protein -
  KJP53_RS16370 (NRS6190_16240) - 3146679..3147047 (+) 369 WP_003243784.1 hypothetical protein -
  KJP53_RS16375 (NRS6190_16245) pdeH 3147023..3148252 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  KJP53_RS16380 (NRS6190_16250) pncB 3148389..3149861 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=1038653 KJP53_RS16350 WP_003242801.1 3144839..3145006(-) (comX) [Bacillus subtilis isolate NRS6190]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=1038653 KJP53_RS16350 WP_003242801.1 3144839..3145006(-) (comX) [Bacillus subtilis isolate NRS6190]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A8D470

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1