Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   ACB089_RS00095 Genome accession   NZ_CP167122
Coordinates   11897..12409 (+) Length   170 a.a.
NCBI ID   WP_374964583.1    Uniprot ID   -
Organism   Lysinibacillus sp. RS10     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 106..39610 11897..12409 within 0


Gene organization within MGE regions


Location: 106..39610
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACB089_RS00010 (ACB089_00010) - 106..1260 (-) 1155 WP_374964561.1 tyrosine-type recombinase/integrase -
  ACB089_RS00015 (ACB089_00015) - 1637..2035 (-) 399 WP_374967628.1 helix-turn-helix domain-containing protein -
  ACB089_RS00020 (ACB089_00020) - 2009..2197 (-) 189 Protein_3 helix-turn-helix domain-containing protein -
  ACB089_RS00025 (ACB089_00025) - 2358..2594 (+) 237 WP_374964563.1 helix-turn-helix transcriptional regulator -
  ACB089_RS00030 (ACB089_00030) - 2612..3313 (+) 702 WP_374964565.1 ORF6N domain-containing protein -
  ACB089_RS00035 (ACB089_00035) - 3375..3701 (+) 327 WP_374964567.1 helix-turn-helix transcriptional regulator -
  ACB089_RS00040 (ACB089_00040) - 3866..4387 (+) 522 WP_374964569.1 XRE family transcriptional regulator -
  ACB089_RS00045 (ACB089_00045) - 4384..4635 (+) 252 WP_374964570.1 hypothetical protein -
  ACB089_RS00050 (ACB089_00050) - 4829..5002 (+) 174 WP_374964572.1 hypothetical protein -
  ACB089_RS00055 (ACB089_00055) - 5033..5767 (+) 735 Protein_10 hypothetical protein -
  ACB089_RS00060 (ACB089_00060) - 5858..6142 (+) 285 WP_374967663.1 hypothetical protein -
  ACB089_RS00065 (ACB089_00065) - 6438..8453 (+) 2016 WP_374964573.1 AAA family ATPase -
  ACB089_RS00070 (ACB089_00070) bet 8456..9220 (+) 765 WP_374964575.1 phage recombination protein Bet -
  ACB089_RS00075 (ACB089_00075) - 9221..9922 (+) 702 WP_374964576.1 MBL fold metallo-hydrolase -
  ACB089_RS00080 (ACB089_00080) - 9935..10615 (+) 681 WP_374964577.1 hypothetical protein -
  ACB089_RS00085 (ACB089_00085) - 10640..11686 (+) 1047 WP_374964579.1 DnaD domain protein -
  ACB089_RS00090 (ACB089_00090) - 11679..11900 (+) 222 WP_374964581.1 DUF6877 family protein -
  ACB089_RS00095 (ACB089_00095) ssbA 11897..12409 (+) 513 WP_374964583.1 single-stranded DNA-binding protein Machinery gene
  ACB089_RS00100 (ACB089_00100) - 12435..12968 (+) 534 WP_374964584.1 NUMOD4 domain-containing protein -
  ACB089_RS00105 (ACB089_00105) - 12980..13147 (+) 168 WP_374964586.1 hypothetical protein -
  ACB089_RS00110 (ACB089_00110) - 13152..13277 (+) 126 WP_374964588.1 hypothetical protein -
  ACB089_RS00115 (ACB089_00115) - 13277..13894 (+) 618 WP_374964590.1 dUTP diphosphatase -
  ACB089_RS00120 (ACB089_00120) - 13973..14485 (+) 513 WP_374964591.1 Holliday junction resolvase RecU -
  ACB089_RS00125 (ACB089_00125) - 14740..14943 (+) 204 WP_374964593.1 hypothetical protein -
  ACB089_RS00130 (ACB089_00130) - 14983..15225 (+) 243 WP_374964594.1 hypothetical protein -
  ACB089_RS00135 (ACB089_00135) - 15337..15735 (+) 399 WP_374964596.1 LuxR C-terminal-related transcriptional regulator -
  ACB089_RS00140 (ACB089_00140) - 15757..15963 (+) 207 WP_374964598.1 hypothetical protein -
  ACB089_RS00145 (ACB089_00145) - 16016..16255 (+) 240 WP_374964599.1 hypothetical protein -
  ACB089_RS00150 (ACB089_00150) - 16963..17850 (+) 888 WP_374964601.1 terminase small subunit -
  ACB089_RS00155 (ACB089_00155) - 17843..19126 (+) 1284 WP_374964603.1 PBSX family phage terminase large subunit -
  ACB089_RS00160 (ACB089_00160) - 19139..20635 (+) 1497 WP_374964605.1 phage portal protein -
  ACB089_RS00165 (ACB089_00165) - 20625..20804 (+) 180 WP_374964607.1 hypothetical protein -
  ACB089_RS00170 (ACB089_00170) - 20804..21892 (+) 1089 WP_374964608.1 phage minor capsid protein -
  ACB089_RS00175 (ACB089_00175) - 21910..22125 (+) 216 WP_374964610.1 hypothetical protein -
  ACB089_RS00180 (ACB089_00180) - 22244..22786 (+) 543 WP_374964612.1 phage scaffolding protein -
  ACB089_RS00185 (ACB089_00185) - 22813..23772 (+) 960 WP_374964613.1 capsid protein -
  ACB089_RS00190 (ACB089_00190) - 23787..24041 (+) 255 WP_374964614.1 hypothetical protein -
  ACB089_RS00195 (ACB089_00195) - 24041..24424 (+) 384 WP_374964615.1 hypothetical protein -
  ACB089_RS00200 (ACB089_00200) - 24417..24746 (+) 330 WP_374964617.1 putative minor capsid protein -
  ACB089_RS00205 (ACB089_00205) - 24743..25105 (+) 363 WP_374964619.1 minor capsid protein -
  ACB089_RS00210 (ACB089_00210) - 25111..25494 (+) 384 WP_374964620.1 minor capsid protein -
  ACB089_RS00215 (ACB089_00215) - 25494..25937 (+) 444 WP_374964622.1 phage tail tube protein -
  ACB089_RS00220 (ACB089_00220) - 26020..26457 (+) 438 WP_374964623.1 hypothetical protein -
  ACB089_RS00225 (ACB089_00225) - 26457..27125 (+) 669 WP_374964624.1 Gp15 family bacteriophage protein -
  ACB089_RS00230 (ACB089_00230) - 27144..30893 (+) 3750 WP_374964625.1 hypothetical protein -
  ACB089_RS00235 (ACB089_00235) - 30890..31651 (+) 762 WP_374964627.1 phage tail domain-containing protein -
  ACB089_RS00240 (ACB089_00240) - 31664..33742 (+) 2079 WP_374964629.1 collagen-like protein -
  ACB089_RS00245 (ACB089_00245) - 33764..34150 (+) 387 WP_374964631.1 hypothetical protein -
  ACB089_RS00250 (ACB089_00250) - 34143..34310 (+) 168 WP_374964633.1 hypothetical protein -
  ACB089_RS00255 (ACB089_00255) - 34370..34582 (+) 213 WP_374964635.1 hypothetical protein -
  ACB089_RS00260 (ACB089_00260) - 34613..36403 (+) 1791 WP_374964636.1 phage tail protein -
  ACB089_RS00265 (ACB089_00265) - 36425..36613 (+) 189 WP_374964638.1 hypothetical protein -
  ACB089_RS00270 (ACB089_00270) - 36805..37092 (+) 288 WP_374964640.1 hypothetical protein -
  ACB089_RS00275 (ACB089_00275) - 37082..37339 (+) 258 WP_374964641.1 phage holin -
  ACB089_RS00280 (ACB089_00280) - 37339..37786 (+) 448 Protein_55 N-acetylmuramoyl-L-alanine amidase family protein -
  ACB089_RS00285 (ACB089_00285) - 38080..38646 (-) 567 WP_374964642.1 DUF5067 domain-containing protein -
  ACB089_RS00290 (ACB089_00290) - 39260..39610 (+) 351 WP_374964644.1 hypothetical protein -

Sequence

Protein


Download         Length: 170 a.a.        Molecular weight: 18565.33 Da        Isoelectric Point: 4.8099

>NTDB_id=1038321 ACB089_RS00095 WP_374964583.1 11897..12409(+) (ssbA) [Lysinibacillus sp. RS10]
MINRVVLVGRLTKDPELRYTPNGIASCRFTVAVNRTFSKEGEEKQADFISCVAWRKQAENLANFMKKGNLIGLEGRIQTG
SYEGQDGKRVYTTDVVADSIQFLEPKNGTGGSQSTSNYESRTNTGGTYQGSSQGNYGGNNNQPSYISGNEDPFANSKGPI
EVSEDDLPFD

Nucleotide


Download         Length: 513 bp        

>NTDB_id=1038321 ACB089_RS00095 WP_374964583.1 11897..12409(+) (ssbA) [Lysinibacillus sp. RS10]
TTGATAAATCGTGTCGTTCTAGTTGGCCGGCTTACAAAAGATCCTGAATTACGCTACACACCAAATGGCATTGCATCATG
TCGCTTTACAGTTGCAGTTAACCGTACATTCAGTAAAGAGGGTGAAGAAAAACAAGCTGACTTTATTAGTTGTGTCGCGT
GGCGCAAACAAGCTGAGAATCTAGCGAACTTCATGAAGAAAGGTAATTTAATAGGTTTGGAAGGGCGAATCCAAACAGGC
AGCTATGAAGGGCAGGATGGCAAGCGTGTGTACACTACAGATGTTGTTGCTGACAGCATTCAGTTTTTAGAGCCGAAAAA
CGGTACAGGAGGCTCGCAGAGCACTTCAAACTACGAATCTAGGACAAATACAGGTGGAACGTATCAAGGCAGTTCACAGG
GCAATTATGGTGGTAATAACAACCAGCCAAGTTATATAAGTGGTAATGAAGATCCGTTTGCAAATAGTAAGGGACCTATT
GAGGTATCTGAGGATGATCTCCCTTTTGATTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.814

100

0.565
  ssb Latilactobacillus sakei subsp. sakei 23K

48.256

100

0.488

Multiple sequence alignment