Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   STAB904_RS00665 Genome accession   NZ_CP007241
Coordinates   104203..104487 (+) Length   94 a.a.
NCBI ID   WP_011284422.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain 1E1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 99203..109487
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  STAB904_RS00640 (STAB904_00695) - 101149..101514 (+) 366 WP_038433847.1 DUF1033 family protein -
  STAB904_RS00645 (STAB904_00700) comGA 101607..102545 (+) 939 WP_038433848.1 competence type IV pilus ATPase ComGA Machinery gene
  STAB904_RS00650 (STAB904_00705) comGB 102481..103515 (+) 1035 WP_227868709.1 competence type IV pilus assembly protein ComGB Machinery gene
  STAB904_RS00655 (STAB904_00710) comGC 103517..103843 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  STAB904_RS00660 (STAB904_00715) comGD 103818..104246 (+) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  STAB904_RS00665 (STAB904_00720) comGE 104203..104487 (+) 285 WP_011284422.1 competence type IV pilus minor pilin ComGE Machinery gene
  STAB904_RS00670 (STAB904_00725) comGF 104480..104914 (+) 435 WP_002992738.1 competence type IV pilus minor pilin ComGF Machinery gene
  STAB904_RS00675 (STAB904_00730) comGG 104898..105224 (+) 327 WP_010921801.1 competence type IV pilus minor pilin ComGG -
  STAB904_RS00680 (STAB904_00735) comGH 105322..106275 (+) 954 WP_038433850.1 class I SAM-dependent methyltransferase Machinery gene
  STAB904_RS00685 (STAB904_00740) - 106334..107530 (+) 1197 WP_010921803.1 acetate kinase -
  STAB904_RS00690 (STAB904_00745) - 107717..108025 (+) 309 Protein_89 hypothetical protein -
  STAB904_RS00695 (STAB904_00750) proC 108108..108878 (-) 771 WP_038433852.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10654.59 Da        Isoelectric Point: 8.9043

>NTDB_id=103476 STAB904_RS00665 WP_011284422.1 104203..104487(+) (comGE) [Streptococcus pyogenes strain 1E1]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEITLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=103476 STAB904_RS00665 WP_011284422.1 104203..104487(+) (comGE) [Streptococcus pyogenes strain 1E1]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATTGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATAACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383


Multiple sequence alignment