Detailed information
Bioinformatically predicted
Overview
| Name | degQ | Type | Regulator |
| Locus tag | AB6K15_RS15015 | Genome accession | NZ_CP166492 |
| Coordinates | 3074767..3074907 (+) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain BC248L1-1 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3069767..3079907
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB6K15_RS14990 (AB6K15_14990) | - | 3070073..3070471 (+) | 399 | WP_015240486.1 | YueI family protein | - |
| AB6K15_RS14995 (AB6K15_14995) | - | 3070568..3071119 (+) | 552 | WP_003152033.1 | cysteine hydrolase family protein | - |
| AB6K15_RS15000 (AB6K15_15000) | - | 3071137..3072603 (+) | 1467 | WP_015418109.1 | nicotinate phosphoribosyltransferase | - |
| AB6K15_RS15005 (AB6K15_15005) | - | 3072733..3073956 (+) | 1224 | WP_007408678.1 | EAL and HDOD domain-containing protein | - |
| AB6K15_RS15010 (AB6K15_15010) | - | 3073963..3074304 (-) | 342 | WP_007408677.1 | hypothetical protein | - |
| AB6K15_RS15015 (AB6K15_15015) | degQ | 3074767..3074907 (+) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| AB6K15_RS15020 (AB6K15_15020) | - | 3075115..3075975 (+) | 861 | WP_157774448.1 | polyprenyl synthetase family protein | - |
| AB6K15_RS15025 (AB6K15_15025) | comX | 3075944..3076117 (+) | 174 | WP_012118314.1 | competence pheromone ComX | - |
| AB6K15_RS15030 (AB6K15_15030) | comP | 3076131..3078431 (+) | 2301 | WP_124935036.1 | histidine kinase | Regulator |
| AB6K15_RS15035 (AB6K15_15035) | comA | 3078512..3079156 (+) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| AB6K15_RS15040 (AB6K15_15040) | - | 3079178..3079561 (+) | 384 | WP_012118312.1 | hotdog fold thioesterase | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=1034758 AB6K15_RS15015 WP_003152043.1 3074767..3074907(+) (degQ) [Bacillus velezensis strain BC248L1-1]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=1034758 AB6K15_RS15015 WP_003152043.1 3074767..3074907(+) (degQ) [Bacillus velezensis strain BC248L1-1]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |