Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   AB6911_RS16590 Genome accession   NZ_CP166481
Coordinates   3235993..3236136 (-) Length   47 a.a.
NCBI ID   WP_003327149.1    Uniprot ID   -
Organism   Bacillus atrophaeus strain globigii     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3230993..3241136
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB6911_RS16565 (AB6911_16540) - 3231275..3231655 (-) 381 WP_003327155.1 hotdog fold thioesterase -
  AB6911_RS16570 (AB6911_16545) comA 3231673..3232314 (-) 642 WP_003327154.1 response regulator transcription factor Regulator
  AB6911_RS16575 (AB6911_16550) comP 3232396..3234705 (-) 2310 WP_003327153.1 histidine kinase Regulator
  AB6911_RS16580 (AB6911_16555) comX 3234721..3234942 (-) 222 WP_003327152.1 competence pheromone ComX -
  AB6911_RS16585 (AB6911_16560) - 3234939..3235808 (-) 870 WP_003327151.1 polyprenyl synthetase family protein -
  AB6911_RS16590 (AB6911_16565) degQ 3235993..3236136 (-) 144 WP_003327149.1 degradation enzyme regulation protein DegQ Regulator
  AB6911_RS16595 (AB6911_16570) - 3236596..3236955 (+) 360 WP_003327148.1 hypothetical protein -
  AB6911_RS16600 (AB6911_16575) - 3236974..3238206 (-) 1233 WP_003327147.1 EAL and HDOD domain-containing protein -
  AB6911_RS16605 (AB6911_16580) - 3238344..3239810 (-) 1467 WP_087941835.1 nicotinate phosphoribosyltransferase -
  AB6911_RS16610 (AB6911_16585) - 3239826..3240377 (-) 552 WP_003327145.1 cysteine hydrolase family protein -
  AB6911_RS16615 (AB6911_16590) - 3240485..3240883 (-) 399 WP_003327144.1 YueI family protein -

Sequence

Protein


Download         Length: 47 a.a.        Molecular weight: 5645.61 Da        Isoelectric Point: 8.5787

>NTDB_id=1034694 AB6911_RS16590 WP_003327149.1 3235993..3236136(-) (degQ) [Bacillus atrophaeus strain globigii]
MEKKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKFTYAMKIS

Nucleotide


Download         Length: 144 bp        

>NTDB_id=1034694 AB6911_RS16590 WP_003327149.1 3235993..3236136(-) (degQ) [Bacillus atrophaeus strain globigii]
GTGGAAAAGAAAAAACTTGAAGAAGTGAAACAATTATTATTCCGACTCGAACTTGATATCAAAGAAACGACAGATTCATT
ACGAAACATTAACAAAAGCATTGATCAGCTCGATAAATTCACATATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-47)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

95.455

93.617

0.894

Multiple sequence alignment