Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   AB7T04_RS14815 Genome accession   NZ_CP165780
Coordinates   3009965..3010105 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain L-15     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3004965..3015105
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB7T04_RS14790 (AB7T04_14770) - 3005305..3005688 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  AB7T04_RS14795 (AB7T04_14775) comA 3005710..3006354 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  AB7T04_RS14800 (AB7T04_14780) comP 3006435..3008726 (-) 2292 WP_039254056.1 histidine kinase Regulator
  AB7T04_RS14805 (AB7T04_14785) comX 3008738..3008902 (-) 165 WP_007613432.1 competence pheromone ComX -
  AB7T04_RS14810 (AB7T04_14790) - 3008902..3009813 (-) 912 WP_031378407.1 polyprenyl synthetase family protein -
  AB7T04_RS14815 (AB7T04_14795) degQ 3009965..3010105 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  AB7T04_RS14820 (AB7T04_14800) - 3010571..3010912 (+) 342 WP_014305721.1 hypothetical protein -
  AB7T04_RS14825 (AB7T04_14805) - 3010919..3012139 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  AB7T04_RS14830 (AB7T04_14810) - 3012269..3013735 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  AB7T04_RS14835 (AB7T04_14815) - 3013753..3014304 (-) 552 WP_025853916.1 cysteine hydrolase family protein -
  AB7T04_RS14840 (AB7T04_14820) - 3014401..3014799 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1031753 AB7T04_RS14815 WP_003152043.1 3009965..3010105(-) (degQ) [Bacillus velezensis strain L-15]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1031753 AB7T04_RS14815 WP_003152043.1 3009965..3010105(-) (degQ) [Bacillus velezensis strain L-15]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment